WESV Ed V

WESV 82600 Ed. 10-2011 V Type : DWU-7013U

Guide d’installation et d’utilisation Manuale d’installazione e uso Instrucciones de uso e instalación Guia de instalação e de utilização Installation and user guide Installatie en Gebruiksaanwijzing Installation und Bedienungsanleitung

SOMMAIRE 1 CONSIGNES DE SÉCURITÉ .............p.3 2 COMPOSITION DU KIT .....................p.4 3 CARACTÉRISTIQUES TECHNIQUES

.....................................................................p.4 a. Spéciﬁcités techniques b. Boîtier récepteur c. Caméra (SVCM 82501) 4 INSTALLATION DE LA CAMÉRA ...p.6

a. Description de la caméra b. Installation de la caméra c. Fixation du support caméra d. Connexion de la caméra e. Éclairage infrarouge f. Caméras supplémentaires g. Appairage de la ou des caméras 5 INSTALLATION DU RÉCEPTEUR...p.8 a. Description du récepteur b. Installation du récepteur c. Connexion boîtier récepteur à une TV ou un moniteur 6 FONCTION ET UTILISATION

DU KIT ....................................................... p.10 a. Mise en service b. Connexion des caméras c. Associer la caméra au récepteur d. Visualisation de la caméra ou des caméras e. Réglage du volume sonore f. Fonction Scan Time ou QUAD g. Réglage écran h. Fonction zoom i. Qualité du signal

)

7 AFFICHAGE SUR UN PC ................ p.14

8 UTILISATION DU KIT

AVEC UN PC ........................................... p.15 a. Installation software avec cd-rom fourni «GUARDING HOME EDITION» b. Connexion du récepteur c. Présentation du logiciel «Enreg. protection» I - INDICATEUR DE CONNEXION CAMÉRA ET DE SON II - RÉGLAGES DE SECURITÉ a. Détection de mouvement b. Programmation des événements d’enregistrement c. Programmation répertoire d’enregistrement III - CAPTURE VIDÉO IV - PRISE PHOTO V - LISTE ÉVÈNEMENTS VI - CONFIGURATION DE L’AFFICHAGE a. App : non utilisé b. Afﬁchage c. Langues VII -A PROPOS ? VERSION LOGICIEL VIII -ZOOM / PANNEAU DE CONTRÔLE DE DIRECTION 9 MAINTENANCE .............................. p.25 10 DÉPANNAGE ................................... p.25 11 CONSIGNES DE SÉCURITÉ .......... p.26 12 AVERTISSEMENT FCC/CE.............. p.27

CFI EXTEL WESV 82600 - 10/2011 - V1

CONFIGURATION MINIMALE

Processeur d’au moins 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB Mémoire RAM recommandé 1 GB d’espace libre sur disque dur Moniteur couleur avec carte vidéo 16 bits minimum Résolution de moniteur 1024x768 min 96 dpi Carte Graphique compatible Microsoft Direct X9 ou supérieur Lecteur CD-ROM pour l’installation du logiciel Un port USB libre (1.1 ou plus) Logiciel uniquement compatible avec ce kit.

1. CONSIGNES DE SÉCURITÉ Important ! • Veuillez lire le manuel d’utilisation soigneusement avant d’installer ou d’utiliser ce produit. • Si vous installez ce produit pour d’autres, pensez à laisser le manuel ou une copie à l’utilisateur ﬁnal. Avertissement : • Les différents éléments ne devront être démontés que par un technicien autorisé. Mesures de sécurité : • Pour une exploitation en toute sécurité de ce système, il est essentiel que les installateurs, utilisateurs et techniciens suivent toutes les procédures de sûreté décrites dans ce manuel. • Des avertissements spéciﬁques et des symboles d’attention sont indiqués sur les éléments si nécessaire. L’utilisateur de ce produit est responsable et se doit de vériﬁer que l’utilisation qui en sera faite est conforme à la loi en vigueur pour la vidéo surveillance dans le pays d’utilisation IMPORTANT (En France : Se renseigner auprès de la préfecture de votre département Hors France : Se renseigner auprès des autorités compétentes en matière d’utilisation de produits de vidéo surveillance (Direction des libertés publiques, Bureau de la réglementation générale…)

Bien que digitales, les caméras sont sujettes à l’interférence des téléphones sans ﬁl, des micro-ondes et d’autres dispositifs sans ﬁl fonctionnant sur du 2,4 GHz (WIFI par exemple). Maintenez le système à plus de 3 m des dispositifs pendant l’installation et l’utilisation. CFI EXTEL WESV 82600 - 10/2011 - V1

)

2. COMPOSITION DU KIT

• 1 caméra sans ﬁl 2.4 GHz • 1 boitier récepteur 2.4 GHz • 1 support pour le récepteur • 2 adaptateurs de 5VDC pour la caméra et le récepteur • 1 sac de vis • 1 câble RCA-Jack pour sortie Audio/Vidéo • 1 câble USB • 1 CD, logiciel de vidéosurveillance pour PC • 1 manuel d’utilisation

3. CARACTERISTIQUES TECHNIQUES a. Spéciﬁcités techniques RF spéciﬁcation Fréquence radio 2,402-2,454 GHz Modulation numérique GFSK : Frequency Hopping Spread Spectrum Anti-interférence Débit de fréquence : 2Mbps Largeur de bande de chaîne : 2MHz

)

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Boîtier récepteur Alimentation : 5 VDC. Consommation : 300 mA. Canaux : 4. Fréquence de réception : 2,402-2,454 GHz. Dimensions : « 85 x 82 x 25 (mm) ». Poids : 140 grammes. Température d’utilisation : -10°C à + 50° C environ. AV OUT : Connexions Jacks audio/vidéo : Prise jack 3,5 mm. PC OUT : Connexion USB

c. Caméra (SVCM 82501) Alimentation : 5 VDC. Consommation : 1000 mA. Canaux : 4. Transmission de fréquence : 2,402-2,454 GHz. Sensibilité à la lumière : 1-8 lux* (* Prévoir un éclairage supplémentaire pour la nuit). Éclairage infrarouge : 24 diodes Infrarouges. Poids (sans support) : 240 g. T° de fonctionnement : -10°C à 40° C environ. Dimensions : 164 x 64 x 42 (mm). Résolution : 640 x 480 pixels à 25 images/s. Angle de vision : 53°. Liaison digitale entre la caméra et le récepteur (cette technologie limite les interférences et les perturbations dans la liaison). Portée : approximativement 150 m en champs libre.

CFI EXTEL WESV 82600 - 10/2011 - V1

)

4. INSTALLATION DE LA CAMÉRA

ATTENTION

S’assurer qu’aucun élément ne gène l’insertion des vis dans le mur.

a. Description de la caméra 1 11

10

2

3

4 7

3

8

9

12 13

14 6

1. Antenne orientable à visser au dos de la caméra. 2. Protection des caméras (IP 44). (Utilisation extérieure sous abris) 3. Objectif de la caméra. 4. Vis pour ﬁger la position de la caméra. 5. Support de la caméra. 6. Micro (dans la partie vide du caisson). 7. Prise pour raccorder l’adaptateur. 8. Cellule pour activer les diodes IR, dans l’obscurité. 9. Diodes infrarouges (éclairage non visible). 10. Voyant rouge, conﬁrmant l’alimentation de la caméra. 11. Voyant vert, signale que la caméra est afﬁchée sur le moniteur. 12. Vis de ﬁxation pour l’arceau. 13. Bouton pour associer la caméra avec son moniteur : « Pairing key ». 14. Adaptateur 5 VDC.

b. Installation de la caméra Choisissez un emplacement approprié pour l’installation de la caméra. Dans la mesure du possible votre système doit être installé dans un lieu sans poussière, avec de faibles vibrations et une bonne circulation de l’air et être équipé d’une prise murale pour l’adaptateur 5 VDC. En installant la caméra, vériﬁez la bonne réception des images sur le moniteur avant l’installation ﬁnale. Faites par exemple tenir par quelqu’un la caméra dans le secteur à surveiller. Faites déplacer par une autre personne le moniteur à différents endroits dans la maison pour contrôler la bonne réception. Si vous rencontrez des interférences ou d’autres problèmes, merci de vous référez au chapitre « Maintenance ». )

CFI EXTEL WESV 82600 - 10/2011 - V1

Assemblage des différents éléments composant la caméra (A), vous avez la possibilité de déplacer l’arceau de ﬁxation de la caméra (B) si vous devez positionner le support orientable au plafond (C).

A

B

C

c. Fixation du support caméra • Assurez-vous qu’aucun élément ne gène l’installation. • Recherchez un endroit approprié pour ﬁxer le support. • Vissez la partie murale avec les vis fournies. (Utiliser des chevilles si nécessaire). • Vissez la caméra sur le support. • Pointez la caméra dans la direction désirée et serrez la vis latérale de maintien.

d. Connexion de la caméra 1. Reliez le cordon de l’adaptateur 5VDC dans la ﬁche « Alimentation » de la caméra. 2. Branchez l’adaptateur dans une prise 230 VAC (le voyant rouge s’allume).

CFI EXTEL WESV 82600 - 10/2011 - V1

)

e. Éclairage infrarouge Les diodes infrarouges ne produisent pas de lumière visible à l’œil nu. L’éclairage infrarouge s’active automatiquement dans l’obscurité.

f. Caméras supplémentaires Vous avez la possibilité de compléter votre installation avec des caméras supplémentaires (le récepteur accepte jusqu’à 4 caméras).

g. Appairage de la ou des caméras La caméra fournie avec le kit est déjà appairée, chaque caméra supplémentaire doit être également « associée » au récepteur. Si ce n’est pas le cas, reportez-vous au chapitre 6-c « Associer la caméra au récepteur ».

5. INSTALLATION DU RÉCEPTEUR Installez le récepteur à approximativement 1 m au-dessus du sol (pour des conditions de réception optimales). Pour l’installation du récepteur, choisissez un emplacement éloigné des murs en béton armé, miroirs, étagères en métal, etc... Éloignez le récepteur de tous les appareils créant des interférences électriques fortes. N’importe quel environnement électrique fort peut causer des interférences et perturber l’utilisation (WIFI en particulier).

a. Description du récepteur

1

9

12 11 13

2 M

3

4 5 6

14

7

)

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Antenne orientable à visser au dos du récepteur. 2. Sortie Audio/Vidéo sur mini-jack. 3. Entrée d’alimentation 5VDC. 4.Voyant d’activité caméra. • si il est vert aucune caméra est appairée. • si il est éteint au moins une caméra est appairée. 5. Voyant clignote rouge pendant le décompte d’appairage d’une caméra, puis s’éteint dès l’enregistrement de la caméra. 6. Voyant vert conﬁrmant l’alimentation du récepteur. 7. Adaptateur 5 VDC. 8. Câble Audio/Vidéo. 9. Support boîtier récepteur. 10. Câble USB. 11. Prise USB. 12. Pavé directionnel STWX et bouton « M » qui permet d’afﬁcher le menu (via TV). 13. Bouton permet de zoomer le vidéo. 14. Bouton permet d’appairer et sélectionner les caméras.

b. Installation du récepteur

Faites coulisser le support dans le rail approprié.

ATTENTION

Placer uniquement le récepteur sur des surfaces dures et stables.

CFI EXTEL WESV 82600 - 10/2011 - V1

)

c. Connexion boîtier récepteur à une TV ou un moniteur

2 1 Audio

Video

Ne pas utiliser le câble USB pour ce type de branchement.

Dans le cas d’une mauvaise image, vériﬁer que le format du signal vidéo choisi est compatible avec votre écran. 1. Les appareils hors tension 2. Raccorder les deux appareils à l’aide du cordon RCA/Jack fourni 3. Connecter le câble mini jack à l’arrière du récepteur sur la sortie AV out et les embouts RCA jaune (vidéo) et blanc (audio). (Voir image ci-dessus) 4. Reliez le cordon de l’adaptateur 5VDC dans la ﬁche « alimentation » du récepteur. 5. Branchez l’adaptateur dans une prise de courant 230 VAC : le voyant s’illumine en vert. 6. Mettre sous tension le moniteur

6. FONCTION ET UTILISATION DU KIT a. Mise en service Appuyez sur la touche récepteur).

Marche Arrêt (utilisez cette même touche pour arrêter le boîtier

b. Connexion des caméras 1-Reliez le cordon de l’adaptateur 5VDC dans l’entrée « alimentation » de la caméra. 2-Branchez l’adaptateur dans une prise de courant.

)

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Associer la caméra au récepteur Lors de la première mise en service la caméra contenue dans le kit est déjà appairée. Dans le cas contraire ou pour ajouter une autre caméra procéder comme ci-dessous : Appuyer sur la touche « M » du boîtier récepteur et aller sur le menu « PAIR CAM » avec la touche T. Choisir un canal libre entre 1, 2, 3 et 4 avec les touches W et X . Appuyer sur la touche pour lancer l’enregistrement. Vous avez 60 secondes pour appairer la caméra. Soulever le cache située à l’arrière de votre caméra puis enfoncer le bouton « Pairing key » à l’aide d’un objet pointu (par exemple un trombone). Seul un canal par caméra peut être activé sur le récepteur. Dans le cas de plusieurs caméras, vous devez choisir 1 canal différent pour chaque caméra.

d.Visualisation de la caméra ou des caméras Pour visualiser une ou plusieurs caméras (si vous avez installé des caméras supplémentaires), utiliser la touche . Attention, dans le cas de plusieurs caméras, vous devez vous assurer qu’elles soient paramétrées en visualisation dans le menu. Pour cela, appuyer sur la touche « M » du récepteur, et vous assurer que les canaux des caméras enregistrées soient à l’état « ON ». Exemple : « CAM ON » Pour modiﬁer, sélectionner le canal avec la touche T et modiﬁer l’état avec les touches W et X . Les caméras en position « OFF » ne seront pas visibles lors du déﬁlement manuel ou automatique. Le chiffre en haut à gauche de l’écran indique la caméra sélectionnée.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

)

e. Réglage du volume sonore Appuyer sur la touche « ok » un menu apparaît :

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Augmenter ou baisser le son avec les touches W et X du moniteur.

f. Fonction Scan Time ou QUAD (à utiliser seulement dans le cas de plusieurs caméras)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

)

Appuyer sur le bouton « M » du récepteur. Sur « SCAN TIME » avec les touches W et X , sélectionner le temps de déﬁlement (5,10, 15, 20 secondes) ou Afﬁchage en mode QUAD

(Rappel : seules les caméras en mode de visualisation «ON» seront visibles, voir paragraphe d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

La caméra 1 en haut à gauche de l’écran La caméra 2 en haut à droite de l’écran La caméra 3 en bas à gauche de l’écran La caméra 4 en bas à droite de l’écran Écran noir pour les caméras non connectées ou non activées (OFF).

CH3

CH4

A noter : en mode QUAD les touches « M », et ne sont plus actives. Vous devez d’abord sortir du mode QUAD en appuyant sur S TW X .

h. Fonction zoom Appuyer sur le bouton de la télécommande pour zoomer la vidéo de la camera sélectionnée. Vous avez la possibilité de déplacer la vidéo zoomée à l’aide des ﬂèches STWX de la télécommande ou du moniteur. Appuyer de nouveau sur ce même bouton pour retrouver la vidéo initiale.

i. Qualité du signal La qualité de réception est représentée par des barres à gauche du symbole antenne en haut à gauche de la vidéo. Plus le nombre de barres est élevé plus la qualité du signal est bonne. Voir tableau ci-dessous.

Niveau du signal

Débit

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

725~1062Kbps

3~5Fps

12~20Fps

Moyen

543~725Kbps

2~4Fps

8~15Fps

Bas

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Très bon Bon

Absent

Afﬁchage

CFI EXTEL WESV 82600 - 10/2011 - V1

)

7. AFFICHAGE SUR UN PC

1

2

Ne pas utiliser le câble RCA pour ce type de branchement

ATTENTION

)

Vous devez obligatoirement avoir installé sur votre PC le logiciel fourni avant de connecter le récepteur.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. UTILISATION DU KIT AVEC UN PC a. Installation software avec cd-rom fourni « GUARDING HOME EDITION » Insérer le cd-rom fourni dans votre lecteur CD pour installer le logiciel “GUARDING RECORDER”. Démarrage d’installation « Autorun »

Cochez la langue de votre choix, valider par »

Valider par »

Suivez les instructions « ok »

Cliquez sur « suivant » pour continuer Cliquez sur « parcourir » pour changer de dossier

CFI EXTEL WESV 82600 - 10/2011 - V1

)

Enregistrement licence logiciel : Pendant l’installation enregistrer le nom et le code indiqué sur la pochette du cd-rom fourni, respecter impérativement minuscules et majuscules et la syntaxe du code : xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Connexion du récepteur

2

Connecter le câble USB (fourni dans le kit) sur la ﬁche adaptée à l’arrière du récepteur et sur un port USB disponible d’un PC. Dès le branchement un message indique que le matériel est prêt à l’emploi en bas a gauche du moniteur. Double cliquer sur l’icône apparue sur votre bureau.

)

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Présentation du logiciel «ENREG PROTECTION»

Insérer le programme sur la barre en bas à gauche - Réduire le programme sur la barre des taches x Fermer le programme F

Extension menus

Indicateur des caméras

1

2

3

4

5

6

7

8

1. Indicateur de connexion caméra et de son 2. Réglages de sécurité 3. Capture vidéo 4. Prise photo 5. Liste des évènements 6. Conﬁguration de l’afﬁchage 7. A propos ? Version logiciel – Maj – Enregistrement licence 8. Zoom /Panneau de control direction

CFI EXTEL WESV 82600 - 10/2011 - V1

)

I - INDICATEUR DE CONNEXION CAMÉRA ET DE SON

Indique la qualité du signal caméra et son actifs Indique pas de caméra connectée et pas de son actif

II - RÉGLAGES DE SÉCURITÉ

a. Détection de mouvement : Vous pouvez utiliser votre système de vidéo surveillance comme système d’alarme. Un mouvement dans le champ de la caméra déclenchera une alarme et un enregistrement en fonction de la conﬁguration que vous aurez paramétrée.

Niveau de sensibilité Réglage de 0 à 100 Réglage du la durée de l’alarme

Réglage alarme seule ou alarme et enregistrement : à chaque détection un enregistrement s’effectuera dans le dossier paramétré par l’utilisateur Sauvegarde les réglages Chapitre a. Chapitre b. Chapitre c.

)

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programmation des événements d’enregistrement Paramétrage sur 24h

Segmentation par section de 2h Choix du type d’événement Choix de la caméra affectée par le type d’évènement Choix de la résolution Choix du format enregistré lors d’une détection (clip vidéo ou photo) Cliquer sur cette icône pour sauvegarder les réglages

: permet d’enregistrer une vidéo sur une plage horaire indiquée. La vidéo s’enregistre directement dans le dossier choisi par l’utilisateur (voir chapitre suivant). : une détection de mouvement active une prise de ﬁlm ou une prise série de photo. Un seul ﬂux vidéo s’enregistre (1 seule caméra à la fois).

c. Programmation répertoire d’enregistrement Paramétrage du répertoire d’enregistrement en cliquant sur l’icône dossier jaune. Possibilité de changer votre dossier d’enregistrement. Paramètre de temps de sauvegarde d’un ﬁcher. Exemple : 7 jours ou moins. Si validé, les ﬁchiers sont conservés. Cliquer sur cet icône pour sauvegarder les réglages.

CFI EXTEL WESV 82600 - 10/2011 - V1

)

III - CAPTURE VIDÉO Choix d’un répertoire d’enregistrement Effacement de la vidéo précédemment enregistrée 1. Enregistrement de la vidéo afﬁchée à l’écran Un point rouge apparaît alors à l’écran 2. Ralentissement de la vidéo en mode lecture jusqu’à /16 3. Lecture de la vidéo enregistrée 4. Accélération de la vidéo en mode lecture jusqu’a x10 5. Arrêt de la vidéo pendant le mode lecture

1

2

3

4

5

IV. - PRISE PHOTO

1

2

3

4

5

6 1. En cliquant sur l’icône, permet de prendre une photo de l’image afﬁchée à l’écran – les photos s’enregistrent de façon temporaire dans le rectangle en dessous 2. Enregistre les photos prises dans un dossier de votre choix 3. Efface les photos des plus récentes aux plus anciennes 4. Enregistre toutes les photos indiquées sous le rectangle dans un répertoire de votre choix 5. Supprime toutes les photos indiquent sous le rectangle 6. Imprime une photo sélectionnée en surbrillance dans le rectangle

)

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LISTE ÉVÈNEMENTS 1

2

3

4

5

1. Trie les prises par nom de caméra 2. Trie les prises par ancienneté des dates 3. Trie les prises par mode (type de prise de vue) photo ou clip … 4. Suppression d’une prise 5. Suppression de toutes les différentes prises photo et vidéo

indique la date et l’heure d’une alarme par détection et prise de vidéo de format « avi ». En sélectionnant « en surbrillance » le ﬁchier vidéo un panneau de contrôle apparaît :

- ralentissement de la vidéo en mode lecture jusqu’a /16 - lecture de la vidéo enregistrée - accélération de la vidéo en mode lecture jusqu’a x10 - arrêt de la vidéo pendant le mode lecture

CFI EXTEL WESV 82600 - 10/2011 - V1

)

indique la date et l’heure d’une alarme par détection et prise de photos.

Pour chaque fonction des événements, le dossier d’enregistrement est différent. Le programme inscrit dans le dossier d’enregistrement sélectionné, chaque groupement différent selon la fonction.

Dossier pour alarme avec détection programmée Dossier pour capture vidéo programmée Dossier clip vidéo contrôlé par l’utilisateur

)

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURATION DE L’AFFICHAGE

Cliquer sur l’icône Chapitre a. Chapitre b. Chapitre c.

Le menu suivant apparaît

a. App : non utilisé

b. Afﬁchage 'XUpHWDPSRQ$IÀFKHRXFDFKHO·KRUORJH HWODGDWH 1RPFDP$IÀFKHRXFDFKHOHQRPGHOD FDPpUD 3HUPHWGHQRPPHUOHVFDPpUDV ,PSRUWDQW &OLTXHUVXUFHWLF{QHSRXUVDXYHJDUGHU

c. Langues

Sélection de la langue utilisée pour le logiciel.

CFI EXTEL WESV 82600 - 10/2011 - V1

)

VII - A PROPOS ? VERSION LOGICIEL

Cliquer sur l’icône

1-Indique la version du logiciel 2-Indique l’activation (enregistrement licence) du logiciel 3-Vériﬁe les mises à jour du logiciel par Internet (non utilisé)

VIII - ZOOM / PANNEAU DE CONTROLE DE DIRECTION

Afﬁchage normal

)

Mode zoom actif (les ﬂèches deviennent alors valides).

CFI EXTEL WESV 82600 - 10/2011 - V1

9. MAINTENANCE La garantie s’annule si vous démontez les pièces. Nettoyer l’extérieur seulement avec un tissu sec et doux. Avant le nettoyage, débrancher ou mettez hors de tension le système de vidéosurveillance. ATTENTION : N’employer aucun produit ou essence d’épuration carboxylique, alcool ou similaire. En plus de risquer d’endommager votre appareil, les vapeurs sont également dangereuses pour votre santé et explosives. N’employer aucun outil pouvant être conducteur de tension (brosse en métal, outil pointu... ou autre) pour le nettoyage.

10. DÉPANNAGE Avec ce système de vidéosurveillance, vous avez acheté un produit de dernière technologie et qui est prêt à l’emploi. Toutes les pièces sont fournies pour pouvoir utiliser votre kit pleinement. Cependant si vous rencontrez des problèmes ou des défauts de fonctionnement, vous pouvez remédier à ces défauts en lisant le tableau suivant : Panne

Cause

Solution

Le récepteur ne s’allume pas

Problème d’alimentation

Vériﬁer le branchement de l’adaptateur

Pas d’image et indication « pas de signal »

• La caméra n’est pas alimentée • La caméra n’est pas appairée • Le signal n’est pas reçu par le récepteur

• Vériﬁer le branchement de l’adaptateur • Vous reporter au Chapitre 6. c. • Rapprocher la caméra et trouver un emplacement plus approprié

Impossible d’afﬁcher les caméras supplémentaires

Les caméras ne sont pas validées sur le récepteur

Vous reporter au Chapitre 6. d.

La télécommande ne fonctionne pas

• Si 1ère utilisation, retirer la protection pile transparente • Remplacer la pile

En cas de besoin, note site technique est à votre disposition : www.cﬁ-extel.com HOTLINE : 0892 35 00 69 (0,337€ ttc/min) CFI EXTEL WESV 82600 - 10/2011 - V1

)

11. MESURES DE SÉCURITÉ Les dommages provoqués par le manque de conformité au manuel mènent à l’expiration de la garantie. Nous n’assumerons aucune responsabilité pour les dommages en résultant ! Nous n’assumerons aucune responsabilité concernant tout dommage, sur les biens ou les personnes, causé par une mauvaise manipulation ou par manque de conformité aux consignes de sécurité. Ce produit à été fabriqué dans le respect total des consignes de sécurité. Aﬁn de maintenir ce statut et d’assurer la meilleure exploitation du produit, l’utilisateur doit observer les consignes et avertissements de sûreté contenus dans ce manuel. L’utilisateur de ce système en est responsable et se doit de vériﬁer si la vidéosurveillance est conforme à la loi en vigueur dans le pays d’utilisation.

ATTENTION

Avertit l’utilisateur de la présence d’instructions importantes concernant l’utilisation et l’entretien (la réparation) dans la documentation accompagnant l’appareil.

Avertit l’utilisateur de la présence de « tensions dangereuses », non isolées à l’intérieure du boîtier du produit, d’une importance sufﬁsante pour représenter un risque d’électrocution pour les personnes.

Ce symbole indique un risque de choc électrique ou un risque de court-circuit. - Vous ne devez utiliser ce produit qu’à une tension comprise entre : 100-240 Volts et 50-60 hertz. N’essayer jamais d’utiliser cet appareil avec une tension différente. - Veillez à ce que tous les raccordements électriques du système soient conformes aux consignes d’utilisation. - Dans les établissements commerciaux, assurez-vous d’observer les règles de prévention des accidents pour les installations électriques. - Dans les écoles, les équipements de formation, les ateliers… la présence d’un personnel qualiﬁé est nécessaire pour contrôler le fonctionnement des appareilles électroniques. - Observer les consignes d’utilisation des autres appareils reliés au système. (magnétoscope, TV, PC par exemple) - Veuillez contacter une personne expérimentée au cas où vous auriez des doutes au sujet du mode de fonctionnement ou de la sûreté des appareils. - Ne jamais brancher ou débrancher les appareils électriques avec les mains mouillées. - Lors de l’installation de ce produit, vériﬁer bien que les câbles d’alimentations ne risquent pas d’être endommagés. - Ne remplacez jamais les câbles électriques endommagés vous-même ! Dans ce cas, enlevezles et faites appel à une personne expérimentée.

)

CFI EXTEL WESV 82600 - 10/2011 - V1

12. AVERTISSEMENT FCC/CE Remarque : Cet équipement a été testé et s’est avéré conforme aux limites d’un dispositif de la Classe B, conformément aux normes européennes en vigueur. Ces limites sont conçues pour fournir une protection raisonnable contre les interférences dans une installation résidentielle. Cet équipement, utilise et peut émettre une énergie de fréquence radio et, s’il n’est pas installé et utilisé conformément aux instructions, peut provoquer des interférences aux communications radio. Cependant, il n’y a aucune garantie que les interférences ne se produiront pas dans une installation particulière. Si cet équipement provoque des interférences à la réception radio ou TV ce qui peut être déterminé en mettant l’équipement en marche ou à l’arrêt, l’utilisateur est encouragé à essayer de rectifier les interférences en adoptant au moins l’une des mesures suivantes : • Réorienter ou déplacer l’antenne réceptrice • Augmenter la distance entre l’équipement et le récepteur • Brancher l’équipement sur une prise appartenant à un circuit autre que celui sur lequel est branché le récepteur

Notification FCC/CE Quelques règles doivent être observées : Les appareils utilisant des ondes radios sont obligatoirement conformes aux règles et aux règlements. En tant que tels, la puissance de l'émetteur est limitée. Un récepteur ne peut pas répondre à plus d'un signal à la fois et peut donc être perturbé par des signaux radio proches de ses fréquences de fonctionnement.

CFI EXTEL WESV 82600 - 10/2011 - V1

)

INDICE 1 DISPOSIZIONI DI SICUREZZA 2 COMPOSIZIONE DEL KIT

S

S

3 CARATTERISTICHE TECNICHE

S

D 6SHFLÀFLWjWHFQLFKH E 8QLWjULFHYHQWH F7HOHFDPHUD69&0 4 INSTALLAZIONE DELLA

TELECAMERA S

D 'HVFUL]LRQHGHOODWHOHFDPHUD E ,QVWDOOD]LRQHGHOODWHOHFDPHUD F )LVVDJJLRGHOVXSSRUWRGHOODWHOHFDPHUD G&RQQHVVLRQHGHOODWHOHFDPHUD H ,OOXPLQD]LRQH,QIUDURVVL I7HOHFDPHUHVXSSOHPHQWDUL J$SSDLDPHQWRGHOODRGHOOHWHOHFDPHUH 5 INSTALLAZIONE DEL RICEVITORE ..

... S D 'HVFUL]LRQHGHOULFHYLWRUH E ,QVWDOOD]LRQHGHOULFHYLWRUH F &RQQHVVLRQHXQLWjULFHYHQWHDXQD79RD XQPRQLWRU 6 FUNZIONE E UTILIZZAZIONE

DEL KIT S

D 0HVVDLQVHUYL]LR E &RQQHVVLRQHGHOOHWHOHFDPHUH F$VVRFLDUHODWHOHFDPHUDDOULFHYLWRUH G9LVXDOL]]D]LRQHGHOODWHOHFDPHUDRGHOOH WHOHFDPHUH H 5HJROD]LRQHGHOYROXPHVRQRUR I)XQ]LRQH6FDQ7LPHR48$' J 5HJROD]LRQHVFKHUPR K )XQ]LRQH]RRP L 4XDOLWjGHOVHJQDOH

,7

7 VISUALIZZAZIONE SU UN PC

S

8 UTILIZZAZIONE DEL KIT CON UN

PC S D,QVWDOOD]LRQHGHOVRIWZDUHFRQFGURP IRUQLWR´*8$5',1*+20((',7,21µ E&RQQHVVLRQHGHOPRQLWRU F3UHVHQWD]LRQHGHOVRIWZDUH ´(QUHJ3URWHFWLRQµ , ,1',&$725(',&211(66,21(',7(/(&$ 0(5$(',68212 ,,5(*2/$=,21,',6,&85(==$ a. Rilevamento di movimento: b. Programmazione degli eventi di registrazione c. Programmazione directory di registrazione ,,,5,35(6$9,'(2 ,96&$772)272 9/,67$'(*/,(9(17, 9,&21),*85$=,21('(//$9,68$/,==$=,21( a. Device: non utilizzato b.Visualizzazione (Display) c. Lingue (Language) 9,,,1)29(56,21(62)7:$5( 9,,,=2203$11(//2',&21752//2', ',5(=,21( 9 MANUTENZIONE........................... S 10 RISOLUZIONE DEI PROBLEMI ... S 11 DISPOSIZIONI DI SICUREZZA S 12 AVVERTENZE FCC/CE

CFI EXTEL WESV 82600 - 10/2011 - V1

S

CONFIGURAZIONE MINIMA

Processore di almeno 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB Memoria RAM raccomandato 1 GB di spazio libero su disco duro Monitor a colori con scheda video 16 bit minimo Risoluzione del monitor 1024x768 min 96 dpi Scheda graﬁca compatibile Microsoft Direct X9 o successivi Lettore CD-ROM per l’installazione del software Una porta USB libera (1.1 o più) Software compatibile solo con questo kit.

1. DISPOSIZIONI DI SICUREZZA Importante! • Leggere attentamente il manuale utente prima di installare o utilizzare questo prodotto. • Se il prodotto viene installato per conto terzi, lasciare il presente manuale o copia di esso all’utente ﬁnale. Avvertenza: • I diversi elementi devono essere smontati solo da un tecnico autorizzato. Misure di sicurezza: • Per un utilizzo in assoluta sicurezza del presente sistema, è fondamentale che gli installatori, gli utenti e i tecnici seguano tutte le procedure di sicurezza descritte nel manuale. • Se necessario sono indicati sugli elementi avvertenze speciﬁche e simboli per richiamare l’attenzione.

L’utilizzatore di questo prodotto è responsabile e ha il dovere di veriﬁcare che l’utilizzazione che ne sarà fatto è in vigore conforme alla legge per la video sorveglianza nel paese di utilizzazione. IMPORTANTE In Francia: Informarsi vicino alla prefettura del vostro dipartimento Fuori la Francia: Informarsi vicino alle autorità competenti in materia di utilizzazione di prodotti di video sorveglianza (Direzione delle libertà pubbliche, Ufﬁcio della regolamentazione generale) Nonostante siano digitali, le telecamere sono soggette a interferenze di telefoni cordless, forni a microonde e altri apparecchi senza ﬁlo che funzionino a 2,4 GHz (per esempio WIFI). Tenere il sistema a più di 3 m dagli apparecchi durante l’installazione e l’utilizzo. CFI EXTEL WESV 82600 - 10/2011 - V1

,7

2. COMPOSIZIONE DEL KIT

• 1 telecamera senza ﬁlo 2.4 GHz • 1 unità ricevente 2.4 GHz • 1 supporto per il ricevitore • 2 adattatori da 5VDC per la telecamera e il ricevitore • 1 sacchetto di viti • 1 cavo RCA-Jack per uscita Audio/Video • 1 cavo USB • 1 CD, software di videosorveglianza per PC • 1 manuale utente

3. CARATTERISTICHE TECNICHE a. Speciﬁcità tecniche RF speciﬁca Frequenza radio 2,402-2,454 GHz Modulazione digitale GFSK: Frequency Hopping Spread Spectrum Anti-interferenza Capacità di frequenza: 2Mbps Larghezza di banda: 2MHz

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Unità ricevente Alimentazione: 5V DC. Consumo: 300 mA. Canali: 4. Frequenza di ricezione: 2,402-2,454 GHz. Dimensioni: «85 x 82 x 25 (mm)». Peso: 140 grammi. Temperatura di utilizzo: -10 °C a + 50 °C circa. AV OUT: Connessioni Jack audio/video: Presa jack 3,5 mm. PC OUT : Connessione USB

c. Telecamera (SVCM 82501) Alimentazione: 5V DC. Consumo: 1000 mA. Canali: 4. Trasmissione di frequenza: 2,402-2,454 GHz. Sensibilità alla luce: 1-8 lux* (*Prevedere un’illuminazione supplementare per la notte). Illuminazione infrarossi: 24 diodi infrarossi. Peso (senza supporto): 240 g. Temperatura di funzionamento: -10 °C a 40 °C circa. Dimensioni: 164 x 64 x 42 (mm). Risoluzione: 640 x 480 pixel 25 immagini/s. Angolo di visione: 53°. Collegamento digitale tra la telecamera e il ricevitore (questa tecnologia limita le interferenze e le perturbazioni nel collegamento). Portata: approssimativamente 150 m in campo libero.

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

4. INSTALLAZIONE DELLA TELECAMERA

ATTENZIONE

Sincerarsi che nessun elemento disturbi l’inserimento delle viti nel muro.

a. Descrizione della telecamera 1 2

11

10

3

4 7

3

8

9

12 13

14 6

1. Antenna orientabile da avvitare sul retro della telecamera. 2. Protezione delle telecamere (IP 44). 3. Obiettivo della telecamera. 4.Vite per ﬁssare la posizione della telecamera. 5. Supporto della telecamera. 6. Microfono (nella parte vuota della cassa). 7. Presa per collegare l’adattatore. 8. Fotocellula per attivare i diodi IR nell’oscurità. 9. Diodo infrarosso (illuminazione non visibile). 10. Spia rossa, conferma l’alimentazione della telecamera. 11. Spia verde, segnala che la telecamera è visualizzata sul monitor. 12.Vite di ﬁssaggio per l’archetto. 13. Pulsante per associare la telecamera a un monitor: «pairing key». 14. Adattatore 5 VDC (spina a pipa).

b. Installazione della telecamera. Scegliere un’ubicazione appropriata per l’installazione della telecamera. Nei limiti del possibile, il sistema va installato in un luogo privo di polvere, con poche vibrazioni e con una buona circolazione d’aria; tale luogo deve essere dotato di una presa murale per l’adattatore 5 VDC. Durante l’installazione della telecamera, veriﬁcare la corretta ricezione delle immagini sul monitor prima dell’installazione ﬁnale. Per esempio, far tenere da qualcuno la telecamera nel settore da sorvegliare. Far muovere da un’altra persona il monitor in più posti nella casa per controllare la corretta ricezione. Se compaiono interferenze o altri problemi, fare riferimento al capitolo “Manutenzione”.

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

Assemblaggio dei differenti elementi che compongono la telecamera (A), è possibile spostare l’archetto di ﬁssaggio della telecamera (B) se occorre posizionare il supporto orientabile al sofﬁtto (C).

A

B

C

c. Fissaggio del supporto della telecamera • Sincerarsi che nessun elemento disturbi l’installazione. • Cercare un luogo appropriato per ﬁssare il supporto. • Avvitare la parte a muro con le viti fornite. (Utilizzare tasselli se necessario). • Avvitare la telecamera sul supporto. • Posizionare la telecamera nella direzione desiderata e serrare la vite laterale di appoggio.

d. Connessione della telecamera. 1. Collegare il cordone dell’adattatore 5VDC nella spina «Alimentazione» della telecamera. 2. Inserire l’adattatore in una presa 230 VAC (la spia rossa si illumina).

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

e. Illuminazione infrarossi I diodi infrarossi non producono luce visibile a occhio nudo. L’illuminazione infrarossi si attiva automaticamente con il buio.

f. Telecamere supplementari È possibile completare l’installazione con telecamere supplementari (il ricevitore accetta ﬁno a 4 telecamere).

g. Appaiamento della o delle telecamere La telecamera fornita con il kit è già appaiata; ogni altra telecamera deve ugualmente essere “associata” al ricevitore. In caso contrario, far riferimento al capitolo 6-c “Associare la telecamera al ricevitore”.

5. INSTALLAZIONE DEL RICEVITORE Installare il ricevitore a 1 m circa dal suolo (per condizioni di ricezione ottimali). Per l’installazione del ricevitore, scegliere un’ubicazione che sia lontana da muri in cemento armato, specchi, scaffalature in metallo ecc. Allontanare il ricevitore da qualunque apparecchiatura che crei interferenze elettriche forti. Qualunque ambiente elettrico forte può causare interferenze e perturbare l’utilizzo (in particolare il WIFI).

a. Descrizione del ricevitore

1

9

12 11 13

2 M

3

4 5 6

14

7

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Antenna orientabile da avvitare sul retro del ricevitore. 2. Uscita Audio/Video su mini-Jack. 3. Entrata alimentazione 5VDC. 4. Spia d’attività telecamera. • se è verde non vi sono telecamere appaiate. • se è spento almeno una telecamera è appaiata. 5. La spia lampeggia in rosso durante l’appaiamento di una telecamera, poi si spegne non appena la telecamera è stata registrata. 6. La spia verde conferma l’alimentazione del ricevitore. 7. Adattatore 5 VDC. 8. Cavo Audio/Video. 9. Supporto unità ricevente. 10. Cavo USB. 11. Presa USB. 12. Tastierino direzionale STWX pulsante «M» che consente di visualizzare il menù (via TV). 13. Pulsante consente di zoommare il video. 14. Pulsante consente di appaiare e selezionare le telecamere.

b. Installazione del ricevitore

Far slittare il supporto nell’apposita rotaia.

ATTENZIONE

Sistemare il monitor solo su superﬁci rigide e stabili.

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

c. Connessione unità ricevente a una TV o a un monitor

2 1 Audio

Video

Non utilizzare il cavo USB per questo tipo di collegamento

In caso di cattiva qualità dell’immagine, veriﬁcare che il formato del segnale video scelto sia compatibile con lo schermo. 1. Togliere la corrente dagli apparecchi 2. Collegare i due apparecchi per mezzo del cordone RCA/Jack fornito 3. Collegare il cavo mini jack sul retro del monitor all’uscita AV out e gli spinotti RCA jack giallo (video) e bianco (audio). (Vedi immagine sopra) 4. Collegare il cordone dell’adattatore 5VDC nella spina «Alimentazione» del ricevitore. 5. Collegare l’adattatore in una presa di corrente 230 VAC. la spia si illumina in verde. 6. Collegare il monitor alla rete elettrica.

6.FUNZIONE E UTILIZZAZIONE DEL KIT a. Messa in servizio Premere il tasto

On/Off (utilizzare lo stesso tasto per spegnere l’unità ricevente)

b. Connessione delle telecamere 1-Collegare il cordone dell’adattatore 5VDC nell’entrata “alimentazione” della telecamera. 2-Inserire l’adattatore in una presa di corrente.

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Associare la telecamera al ricevitore Al momento della prima messa in servizio la telecamera contenuta nel kit è già appaiata. In caso contrario o per aggiungere un’altra telecamera procedere come segue: Premere il tasto «M» dell’unità ricevente e andare sul menù «PAIR CAM» con il tasto T. Scegliere un canale libero tra 1, 2, 3 e 4 con i tasti W e X . . Premere il tasto per lanciare la registrazione. Sono disponibili 60 secondi per appaiare la telecamera. Sollevare il coperchio situato sul retro della telecamera poi premere il pulsante «Pairing key» per mezzo di un oggetto appuntito (per esempio una graffetta). Può essere attivato sul ricevitore un solo canale per telecamera In caso di più telecamere, occorre scegliere 1 canale differente per ciascuna telecamera.

d.Visualizzazione della telecamera o delle telecamere Per visualizzare una o più telecamere (in caso siano state installate telecamere supplementari), utilizzare il tasto . Attenzione: in caso di più telecamere, bisogna sincerarsi che siano parametrate in visualizzazione nel menù. A tal ﬁne, premere il tasto «M» del ricevitore e sincerarsi che lo stato dei canali delle telecamere registrate sia «ON». Esempio: «CAM ON». Per modiﬁcare, selezionare il canale con il tasto T e modiﬁcare lo stato con i tasti W e X. Le telecamere in posizione «OFF» non saranno visibili al momento dello scorrimento manuale o automatico. Il numero in alto a sinistra dello schermo indica la telecamera selezionata.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

e. Regolazione del volume sonoro Premendo il tasto «ok» appare un menù :

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Aumentare o abbassare il suono con i tasti W e X del monitor.

f. Funzione Scan Time o QUAD (da utilizzare solamente in caso di più telecamere)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

,7

Premere il pulsante «M» del ricevitore. Su «SCAN TIME», con i tasti W e X, selezionare il tempo di scorrimento (5,10, 15, 20 secondi) o Visualizzazione in modalità QUAD.

(Promemoria: solamente le telecamere in modalità di visualizzazione «ON» saranno visibili, vedere paragrafo d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

La telecamera 1 in alto a sinistra dello schermo La telecamera 2 in alto a destra dello schermo La telecamera 3 in alto a sinistra dello schermo La telecamera 4 in alto a destra dello schermo

Schermo nero per le telecamere non connesse o non attivate (OFF). CH3

CH4

Attenzione: in modalità QUAD i tasti «M», e non sono più attivi. Occorre innanzitutto uscire dalla modalità QUAD premendo S TW X .

h. Funzione zoom Premere il pulsante del telecomando per zoommare il video della telecamera selezionata. È possibile muovere il video zoommato per mezzo delle frecce S TW X del telecomando o del monitor. Premere di nuovo lo stesso pulsante per riprendere il video iniziale.

i. Qualità del segnale La qualità di ricezione è rappresentata da alcune barre a sinistra del simbolo dell’antenna in alto a sinistra del video. Più elevato è il numero di barre, migliore è la qualità del segnale. Vedere tabella sottostante. Livello del segnale Molto buono

Visualizzazione

Capacità

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

Buono

725~1062Kbps

3~5Fps

12~20Fps

Medio

543~725Kbps

2~4Fps

8~15Fps

Basso

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Assente

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

7.VISUALIZZAZIONE SU UN PC

1

2

Non utilizzare il cavo RCA per questo tipo di collegamento

ATTENZIONE

,7

Occorre necessariamente aver installato sul PC il software fornito prima di collegare il ricettore.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. UTILIZZAZIONE DEL KIT CON UN PC a. Installazione del software con cd-rom fornito «GUARDING HOME EDITION» Inserire il cd-rom fornito nel lettore CD per installare il software “GUARDING RECORDER”. Avvio dell’installazione «Autorun»

Spuntare la lingua prescelta, Convalidare con »

Convalidare con »

Seguire le istruzioni «ok»

Cliccare su «Next» per continuare Cliccare su «Browse» per cambiare cartella

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

Registrazione licenza del software: Durante l’installazione registrare il nome e il codice indicato sulla custodia del cd-rom fornito. Rispettare imperativamente le minuscole e le maiuscole e la sintassi del codice: xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Connessione del monitor

2

Collegare il cavo USB (fornito nel kit) sulla spina prevista sul retro del monitor e su una porta USB disponibile di un PC. Non appena collegato alla rete elettrica, un messaggio indica che il materiale è pronto per essere impiegato in basso a sinistra del monitor. Fare doppio click sull’icona apparsa sul desktop.

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Presentazione del software «ENREG PROTECTION»

Inserire il programma sulla barra in basso a sinistra - Ridurre il programma sulla barra delle applicazioni x Chiudere il programma F

Estensione menù

Indicatore delle telecamere

1

2

3

4

5

6

7

8

1. Indicatore di connessione di telecamera e suono 2. Regolazioni di sicurezza 3. Ripresa video 4. Scatto foto 5. Lista degli eventi 6. Conﬁgurazione della visualizzazione 7. Info Versione software – Maj – Registrazione licenza 8. Zoom /Pannello di controllo direzione

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

I - INDICATORE DI CONNESSIONE DI TELECAMERA E SUONO

Indica la qualità del segnale telecamera e il suono attivo

Indica nessuna telecamera connessa e il suono inattivo

II - REGOLAZIONI DI SICUREZZA

a. Rilevamento di movimento È possibile utilizzare il sistema di videosorveglianza come sistema d’allarme. Un movimento nel campo della telecamera attiva un allarme e una registrazione in funzione della conﬁgurazione che è stata parametrata.

Livello di sensibilità Regolazione da 0 a 100 Regolazione della durata dell’allarme

Regolazione solo allarme o allarme e registrazione: a ogni rilevamento una registrazione viene eseguita nella cartella parametrata dall’utente Salvataggio delle regolazioni Capitolo a. Capitolo b. Capitolo c.

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programmazione degli eventi di registrazione Parametraggio su 24h

Segmentazione per sezioni di 2h Scelta del tipo di evento Scelta della telecamera destinata per tipo di evento Scelta della risoluzione Scelta del formato registrato al momento del rilevamento (clip video o foto) Cliccare su questa icona per salvare le regolazioni : consente di registrare un video su una fascia oraria indicata. Il video si registra direttamente nella cartella scelta dall’utente (vedere capitolo successivo).

: un rilevamento di movimento attiva una ripresa video o una serie di scatti fotograﬁci. Viene registrato un solo ﬂusso video (1 sola telecamera per volta).

c. Programmazione directory di registrazione Parametraggio della directory di registrazione cliccando sull’icona cartella gialla. Possibilità di cambiare la cartella di registrazione. Parametro del tempo di salvataggio di un ﬁle. Esempio: 7 giorni o meno. Se convalidato, i ﬁle sono conservati. Cliccare su questa icona per salvare le regolazioni.

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

III - RIPRESA VIDEO Scelta di una directory di registrazione Cancellazione precedenza

del

video

registrato

in

1. Registrazione del video visualizzato sullo schermo Appare un punto rosso sullo schermo 2. Rallentamento del video in modalità lettura ﬁno a /16 3. Lettura del video registrato 4. Accelerazione del video in modalità lettura ﬁno a x10 5.Fermo immagine del video in modalità lettura 1

2

3

4

5

IV - SCATTO FOTO

1

2

3

4

5

6 1.Cliccando sull’icona si scatta una foto dell’immagine visualizzata sullo schermo – le foto vengono registrare in maniera temporanea nel rettangolo sottostante 2. Registra in una cartella prescelta le foto scattate 3. Cancella le foto dalle più recenti alle più vecchie 4. Registra tutte le foto indicate sotto il rettangolo in un repertorio prescelto 5. Sopprime tutte le foto indicate nel rettangolo 6.Stampa una foto evidenziata nel rettangolo

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LISTA DEGLI EVENTI 1

2

3

4

5

1.Seleziona le foto in base al nome della telecamera 2. Seleziona le foto in base alla data 3.Seleziona le foto in base alla modalità (tipo di inquadratura) foto o clip… 4. Soppressione di un’inquadratura 5. Soppressione di tutte le differenti inquadrature foto e video

indica la data e l’ora di un allarme per rilevamento e registrazione video di formato «avi». Selezionando « evidenziandolo» il ﬁle video compare un pannello di controllo :

- rallentamento del video in modalità lettura ﬁno a /16 - lettura del video registrato - accelerazione del video in modalità lettura ﬁno a x10 - fermo immagine durante la modalità lettura

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

indica la data e l’ora di un allarme per rilevamento e scatto della foto.

Per ciascuna funzione degli eventi, la cartella di registrazione è differente. Il programma iscrive nella cartella selezionata per la registrazione ciascun raggruppamento differente in base alla funzione.

Cartella per allarme con rilevamento programmato Cartella per ripresa video programmata Cartella clip video controllato dall’utente

,7

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURAZIONE DELLA VISUALIZZAZIONE

Cliccare sull’icona Capitolo a. Capitolo b. Capitolo c.

Appare il seguente menù

a. Device: non utilizzato

b. Visualizzazione (Display) Durata tampone: Visualizza o nasconde l’orologio e la data Nome telecam: Visualizza e nasconde il nome della telecamera

Consente di nominare le telecamere

Importante! Cliccare su questa icona per salvare

c. Lingue (Language)

Selezione della lingua utilizzata per il software.

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

VII - INFO VERSIONE SOFTWARE

Cliccare sull’icona

1-Indica la versione del software 2-Indica l’attivazione (registrazione licenza) del software 3-Veriﬁca gli aggiornamenti del software da Internet (non utilizzato)

VIII - ZOOM /PANNELLO DI CONTROLLO DI DIREZIONE

Visualizzazione normale

,7

Modalità zoom attiva (le frecce diventano valide)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. MANUTENZIONE La garanzia è annullata qualora i pezzi siano stati smontati. Pulire le parti esterne con un panno asciutto e morbido. Prima di pulire, scollegare o togliere la corrente dal sistema di videosorveglianza. ATTENZIONE: Non impiegare nessuna soluzione pulente a base carbonilica, alcool o simili. Oltre al rischio di danneggiare l’apparecchio, i vapori emanati sono pericolosi per la salute ed esplosivi. Non impiegare utensili conduttori di tensione (spazzole in metallo, utensili appuntiti o altro) per la pulizia.

10. RISOLUZIONE DEI PROBLEMI Con questo sistema di videosorveglianza ha acquistato un prodotto di tecnologia di punta pronto per essere usato. Sono forniti tutti i pezzi necessari per poter utilizzare il kit integralmente. Tuttavia, se si riscontrano problemi o difetti di funzionamento, è possibile rimediare a tali difetti leggendo la tabella seguente: Guasto

Causa

Soluzione

Il ricevitore non si accende

Problema di alimentazione

Veriﬁcare il collegamento dell’adattatore

Assenza di immagine e indicazione «nessun segnale»

• La telecamera non è alimentata • La telecamera non è appaiata • Il segnale non è ricevuto dal ricevitore

• Veriﬁcare il collegamento dell’adattatore • Far riferimento al Capitolo 6. c. • Avvicinare la telecamera e trovarle un’ubicazione più idonea

Impossibile visualizzare le telecamere supplementari

Le telecamere non sono convalidate sul ricevitore

Far riferimento al Capitolo 6. d.

Il telecomando non funziona

• Se è la prima utilizzazione, togliere la pellicola trasparente alla pila • Sostituire la pila

In caso di necessità, Il nostro sito tecnico è a vostra disposizione www.cﬁ-extel.com Assistenza Tecnica : +39 02 96488273 assistenza@cﬁ-extel.com CFI EXTEL WESV 82600 - 10/2011 - V1

,7

11. DISPOSIZIONI DI SICUREZZA I danni provocati dalla mancanza di conformità al manuale conducono alla decadenza della garanzia. Non ci assumiamo alcuna responsabilità per i danni che ne potrebbero derivare! Non ci assumiamo altresì responsabilità alcuna per qualsivoglia danno, a persone o beni, causato da una scorretta manipolazione o dalla mancanza di conformità alle disposizioni di sicurezza. Questo prodotto è stato fabbricato nel totale rispetto delle disposizioni di sicurezza. Al ﬁne di mantenere tale condizione e di garantire la migliore utilizzazione del prodotto, l’utente deve osservare disposizioni e avvertenze contenute nel presente manuale. L’utente del presente sistema deve veriﬁcare sotto la sua responsabilità che la sorveglianza sia conforme alle leggi vigenti nel paese di utilizzo.

ATTENZIONE

Avverte l’utente della presenza di istruzioni importanti circa l’utilizzo e la manutenzione (la riparazione) nella documentazione che accompagna l’apparecchio.

Avverte l’utente della presenza di “tensioni pericolose”, non isolate, all’interno della cassa del prodotto, di una gravità sufﬁciente a rappresentare un rischio di folgorazione per le persone.

Questo simbolo indica un rischio di shock elettrico o un rischio di corto circuito. -Questo prodotto deve essere utilizzato a una tensione compresa tra: 100-240 Volt e 50-60 hertz. Non tentare di utilizzare questo apparecchio con una tensione differente. -Sincerarsi che tutti i collegamenti elettrici del sistema siano conformi alle disposizioni di utilizzo. -Nelle strutture commerciali, sincerarsi di osservare le regole di prevenzione degli incidenti concernenti impianti elettrici. -Nelle scuole, nelle strutture formative, nei laboratori… la presenza di personale qualiﬁcato è necessaria per controllare il funzionamento degli apparecchi elettronici. -Osservare le disposizioni di utilizzo degli altri apparecchi collegati al sistema.(videoregistratore, TV, PC per esempio) -Contattare una persona esperta in caso di dubbi circa le modalità di funzionamento o la sicurezza degli apparecchi. - Mai collegare o scollegare gli apparecchi elettrici con le mani bagnate. -Al momento dell’installazione di questi prodotti, veriﬁcare che i cavi di alimentazione non rischino di essere danneggiati. -Mai sostituire da soli dei cavi elettrici danneggiati! Nel caso, toglierli e far ricorso a personale qualiﬁcato. ,7

CFI EXTEL WESV 82600 - 10/2011 - V1

12. AVVERTENZE FCC/CE Nota: Questo apparecchio è stato testato e si è dimostrato conforme ai limiti di un dispositivo di Classe B, conformemente alle norme europee vigenti.Tali limiti sono concepiti per fornire una protezione ragionevole contro le interferenze in un impianto residenziale. Questo apparecchio utilizza e può emettere frequenze radio e, se non installato e utilizzato in maniera conforme alle istruzioni, può provocare interferenze alle comunicazioni radio.

Tuttavia, non vi è alcuna garanzia che tali interferenze non vengano a prodursi in un particolare impianto. Se questo apparecchio provoca interferenze al ricevimento radio o tv, facilmente verificabile mettendolo in funzione o spegnendolo, l’utente può intervenire tentando di rettificare le interferenze adottando almeno una delle misure che seguono: • Riorientare o spostare l’antenna ricevitrice • Aumentare la distanza tra l’apparecchio e il ricevitore • Collegare l’apparecchio a una presa appartenente a un circuito differente da quello in cui è collegato il ricevitore

Notifica FCC/CE Alcune regole da osservare: Gli apparecchi che utilizzano onde radio sono obbligatoriamente conformi alle regole e alle normative. In quanto tali, la potenza dell’emittente è limitata. Un ricevitore non può rispondere a più di un segnale per volta e può dunque essere perturbato da segnali radio vicini alle sue frequenze di funzionamento.

CFI EXTEL WESV 82600 - 10/2011 - V1

,7

ÍNDICE

1 INSTRUCCIONES DE SEGURIDAD ..... p.3

7 VISUALIZACIÓN EN UN PC ......... p.14

2 COMPOSICIÓN DEL KIT ...................p.4

8 UTILIZACIÓN DEL KIT CON UN PC

3 CARACTERÍSTICAS TÉCNICAS .... p.4

a. Datos técnicos b. Receptor c. Cámara (SVCM 82501) 4 INSTALACIÓN DE LA CÁMARA.....p.6 a. Descripción de la cámara b. Instalación de la cámara c. Fijación del soporte de la cámara d. Conexión de la cámara e. Iluminación infrarroja f. Cámaras adicionales g. Emparejamiento de la cámara o cámaras 5 INSTALACIÓN DEL RECEPTOR... ..p.8 a. Descripción del receptor b. Instalación del receptor c. Conexión del receptor a una TV o a un monitor

.................................................................. p.15 a. Instalación del software con el CD-ROM suministrado “GUARDING HOME EDITION” b. Conexión del receptor c. Presentación del software “ENREG. PROTECTION” I - INDICADOR DE CONEXIÓN DE LA CÁMARA Y DE SONIDO II - AJUSTES DE SEGURIDAD a. Detección de -movimiento b. Programación de los eventos de grabación c. Selección del directorio de grabación III - CAPTURA VÍDEO IV - FOTOGRAFÍAS V - LISTA DE EVENTOS VI - CONFIGURACIÓN DE LA VISUALIZACIÓN a. Dispo.: no utilizado b. Pantallas c. Idioma VII - ACERCA DEL SOFTWARE - VERSIÓN DEL SOFTWARE VIII - ZOOM / PANEL DE CONTROL DE DIRECCIÓN

6 FUNCIONAMIENTO Y UTILIZACIÓN

DEL KIT ...................................................... p.10

a. Puesta en marcha b. Conexión de las cámaras c. Asociación de la cámara al receptor d. Visualización de la cámara o cámaras e. Ajuste del volumen sonoro f. Función Scan Time o QUAD g. Ajuste de la pantalla h. Función zoom i. Calidad de la señal

(6

9 MANTENIMIENTO ......................... p.25 10 REPARACIÓN .................................. p.25 11 INSTRUCCIONES DE SEGURIDAD ... p.26 12 INFORMACIÓN FCC/CE ................. p.27

CFI EXTEL WESV 82600 - 10/2011 - V1

CONFIGURACIÓN MÍNIMA

Procesador de al menos 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB de memoria RAM recomendado 1 GB de espacio disponible en el disco duro Monitor color con tarjeta vídeo de 16 bits mínimo Resolución del monitor: 1024x768 mínimo a 96 dpi Tarjeta gráﬁca compatible Microsoft Direct X9 o superior Lector de CD-ROM para la instalación del software Un puerto USB disponible (1.1 o más) Software únicamente compatible con este kit.

1. INSTRUCCIONES DE SEGURIDAD ¡Importante! • Lea detenidamente el manual de instrucciones antes de instalar o utilizar este producto. • Si instala este producto para terceras personas, no olvide entregar el manual de instrucciones o una copia del mismo al usuario ﬁnal. Advertencia: • Los diferentes elementos sólo podrán ser desmontados por un técnico autorizado. Medidas de seguridad: • Para poder utilizar este sistema de manera totalmente segura es indispensable que instaladores, usuarios y técnicos respeten todos los procedimientos de seguridad que se describen en este manual. • Cuando sea necesario, se introducirán avisos especíﬁcos y símbolos de atención junto a los elementos. El usuario será absolutamente responsable de la utilización que haga del producto y deberá comprobar que esta última sea conforme a la ley vigente sobre videovigilancia en el país de destino. IMPORTANTE (En Francia: Infórmese en la prefectura de su departamento En el extranjero: Infórmese ante las autoridades competentes en materia de utilización de productos de videovigilancia). Aunque son digitales, las cámaras pueden sufrir interferencias procedentes de los teléfonos móviles, microondas y demás dispositivos inalámbricos que funcionan a una frecuencia de 2,4 GHz (Wi-Fi por ejemplo). No instale ni utilice el sistema a menos de 3 m de distancia de dichos dispositivos. CFI EXTEL WESV 82600 - 10/2011 - V1

(6

2. COMPOSICIÓN DEL KIT

• 1 cámara inalámbrica 2,4 GHz • 1 receptor 2,4 GHz • 1 soporte para el receptor • 2 adaptadores de 5VDC para la cámara y el receptor • 1 bolsa de tornillos • 1 cable RCA-Jack para la salida Audio/Vídeo • 1 cable USB • 1 CD, software de videovigilancia para PC • 1 manual de instrucciones

3. CARACTERÍSTICAS TÉCNICAS

a. Datos técnicos Especiﬁcaciones RF Frecuencia radio: 2,402-2,454 GHz Modulación digital GFSK: Frequency Hopping Spread Spectrum Anti-interferencias Velocidad de frecuencia: 2 bits/s Ancho de banda: 2 MHz

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Receptor Alimentación: 5 VDC. Consumo: 300 mA. Canales: 4. Frecuencia de recepción: 2,402-2,454 GHz. Dimensiones: 85 x 82 x 25 (mm). Peso: 140 gramos. Temperatura de uso: -10°C a + 50°C aproximadamente. AV OUT: Conexiones Jack Audio/Vídeo: Conector Jack 3,5 mm. PC OUT: Conexión USB

c. Cámara (SVCM 82501) Alimentación: 5 VDC. Consumo: 1000 mA. Canales: 4. Frecuencia de transmisión: 2,402-2,454 GHz. Sensibilidad a la luz: 1-8 lux* (* Prever una iluminación adicional para la noche). Iluminación infrarroja: 24 diodos infrarrojos. Peso (sin soporte): 240 g. Tª de funcionamiento: -10°C a 40°C aproximadamente. Dimensiones: 164 x 64 x 42 (mm). Resolución: 640 x 480 píxeles a 25 imágenes/s. Ángulo de visión: 53°. Conexión digital entre la cámara y el receptor (esta tecnología limita las interferencias y las perturbaciones en la conexión). Alcance: aproximadamente 150 m en campo abierto.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

4. INSTALACIÓN DE LA CÁMARA

ATENCIÓN

Asegúrese de que no haya ningún elemento que impida la inserción de los tornillos en la pared.

a. Descripción de la cámara 1 11

10

2

3

4 7

3

8

9

12 13

14 6

1. Antena orientable para atornillar en la parte trasera de la cámara. 2. Protección de las cámaras (IP 44). 3. Objetivo de la cámara. 4. Tornillo para ﬁjar la posición de la cámara. 5. Soporte de la cámara. 6. Micrófono (en la parte vacía de la carcasa). 7. Conector para enchufar el adaptador. 8. Célula para activar los diodos IR en la oscuridad. 9. Diodo infrarrojo (iluminación no visible). 10. Indicador luminoso rojo (conﬁrma la alimentación de la cámara). 11. Indicador luminoso verde (indica que lo captado por la cámara se está visualizando en el monitor). 12. Tornillo de ﬁjación para el arco. 13. Botón para asociar la cámara con su monitor: “Pairing key”. 14. Adaptador 5 VDC (conector acodado).

b. Instalación de la cámara Escoja un lugar apropiado para la instalación de la cámara. En la medida de lo posible, el sistema deberá instalarse en un lugar sin polvo, donde haya pocas vibraciones, que esté bien ventilado y que disponga de un enchufe de pared para el adaptador de 5 VDC. Al instalar la cámara compruebe que las imágenes se ven correctamente en el monitor antes de la instalación ﬁnal. Por ejemplo, puede pedir que alguien sujete la cámara en el sector que se va a vigilar. Pídale a otra persona que mueva el monitor por diferentes lugares de la casa para controlar la correcta recepción. (6

CFI EXTEL WESV 82600 - 10/2011 - V1

Monte los diferentes elementos que componen la cámara (A). Si desea ﬁjar el soporte orientable al techo (C) puede desplazar el arco de ﬁjación de la cámara (B).

A

B

C

c. Fijación del soporte de la cámara • Asegúrese de que no haya ningún elemento que impida la instalación. • Busque un lugar apropiado para ﬁjar el soporte. • Atornille la parte mural con los tornillos suministrados (utilice tacos si es necesario). • Atornille la cámara al soporte. • Oriente la cámara hacia la dirección deseada y apriete el tornillo lateral de sujeción.

d. Conexión de la cámara 1. Conecte el cable del adaptador 5 VDC al conector de alimentación de la cámara. 2. Enchufe el adaptador a una toma de 230 VAC (el indicador luminoso rojo se encenderá).

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

e. Iluminación infrarroja Los diodos infrarrojos no producen luz visible a simple vista. La iluminación infrarroja se activa automáticamente en la oscuridad.

f. Cámaras adicionales Puede completar la instalación con cámaras adicionales (el receptor admite hasta 4 cámaras).

g. Emparejamiento de la cámara o cámaras La cámara suministrada con el kit ya está emparejada; cada cámara adicional también deberá “asociarse” al receptor. Si no es el caso, consulte el capítulo 6-c “Asociación de la cámara al receptor”.

5. INSTALACIÓN DEL RECEPTORS Instale el receptor a aproximadamente 1 m del suelo (para que las condiciones de recepción sean óptimas). Para la instalación del receptor escoja un lugar donde no haya paredes de hormigón armado, espejos, estanterías de metal, etc. Aleje el monitor de todo aparato susceptible de producir interferencias eléctricas fuertes. Cualquier entorno eléctrico fuerte (Wi-Fi sobre todo) puede provocar interferencias y perturbar la utilización del sistema.

a. Descripción del receptor

1

9

12 11 13

2 M

3

4 5 6

14

7

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Antena orientable para atornillar en la parte trasera del receptor. 2. Salida Audio/Vídeo de tipo mini Jack. 3. Entrada de alimentación 5 VDC. 4. Indicador luminoso de actividad de la cámara. • si está de color verde signiﬁca que no hay ninguna cámara emparejada. • si está apagado signiﬁca que al menos hay una cámara emparejada. 5. Este indicador luminoso parpadea de color rojo mientras se empareja la cámara y se apaga una vez que la cámara está asociada. 6. Indicador luminoso verde (conﬁrma la alimentación del receptor). 7. Adaptador 5 VDC. 8. Cable Audio/Vídeo. 9. Soporte para el receptor. 10. Cable USB. 11. Puerto USB. 12. Teclas de dirección STWX y botón “M” que permite mostrar el menú (en la TV). 13. Botón que permite ampliar o reducir el vídeo. 14. Botón que permite emparejar y seleccionar las cámaras.

b. Instalación del receptor

Deslice el soporte en el raíl adecuado.

ATENCIÓN

El receptor sólo deberá colocarse sobre superﬁcies duras y estables.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

c. Conexión del receptor a una TV o a un monitor

2 1 Audio

Video

No utilice el cable USB para este tipo de conexión.

Si la imagen es de mala calidad, compruebe que el formato escogido para la señal vídeo sea compatible con su pantalla. 1. Apague los aparatos. 2. Conecte los dos aparatos por medio del cable RCA/Jack suministrado. 3. Conecte un extremo del cable mini Jack a la parte trasera del receptor (salida AV out) y el otro extremo a los conectores RCA amarillo (vídeo) y blanco (audio) (ver imagen más arriba). 4. Enchufe el cable del adaptador 5 VDC al conector de alimentación del receptor. 5. Enchufe el adaptador a una toma de corriente de 230 VAC (el indicador luminoso se enciende en color verde). 6. Encienda el monitor.

6. FUNCIONAMIENTO Y UTILIZACIÓN DEL KIT a. Puesta en marcha Pulse la tecla de Encendido/Apagado para encender el receptor (esta tecla también sirve para apagarlo).

b. Conexión de las cámaras 1- Conecte el cable del adaptador 5 VDC a la entrada de alimentación de la cámara. 2- Enchufe el adaptador a una toma de corriente.

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Asociación de la cámara al receptor La cámara del kit ya está emparejada cuando se enciende por primera vez. Si no lo estuviera, o en caso de querer añadir otra cámara, haga lo siguiente: Pulse la tecla “M” del receptor y vaya al menú “PAIR CAM” con la tecla T. Escoja un canal libre entre 1, 2, 3 y 4 con las teclas W y X . Pulse la tecla para lanzar la grabación. Dispondrá de 60 segundos para emparejar la cámara. Levante la tapa situada en la parte trasera de la cámara y pulse el botón “Pairing key” con un objeto punzante (por ejemplo el alambre de un clip). Sólo se podrá activar un canal por cámara en el receptor. Si hay varias cámaras, tendrá que elegir 1 canal diferente para cada cámara.

d.Visualización de la cámara o cámaras Para visualizar una o varias cámaras (en caso de haber instalado cámaras adicionales), utilice la tecla . Atención, si hay varias cámaras tendrá que asegurarse de que estén conﬁguradas en modo visualización en el menú. Para ello, pulse la tecla “M” del receptor y cerciórese de que los canales de las cámaras asociadas estén en estado “ON”. Por ejemplo: “CAM ON”. Para modiﬁcar, seleccione el canal con la tecla T y modiﬁque el estado con las teclas W y X. Las cámaras en posición “OFF” no se verán durante la secuenciación manual o automática. La cifra que aparece en la parte superior izquierda de la pantalla indica la cámara seleccionada.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

e. Ajuste del volumen sonoro Pulse la tecla “OK”, entonces aparecerá un menú:

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Suba o baje el sonido con las teclas W y X del monitor.

f. Función Scan Time o QUAD (sólo se puede utilizar en caso de que haya varias cámaras)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

(6

Pulse el botón “M” del receptor. Una vez en el menú “SCAN TIME”, con las teclas W y X, seleccione el tiempo de secuenciación (5, 10, 15 ó 20 segundos) o Visualización en modo QUAD.

(Recuerde: sólo se verán las cámaras que se encuentran en modo de visualización “ON”, ver apartado d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

La cámara 1 en la parte superior izquierda de la pantalla La cámara 2 en la parte superior derecha de la pantalla La cámara 3 en la parte inferior izquierda de la pantalla La cámara 4 en la parte inferior derecha de la pantalla Pantalla negra para las cámaras no conectadas o no activadas (OFF).

CH3

CH4

Recuerde: en modo QUAD, las teclas “M”, y dejan de estar activas. Para activarlas, primero tiene que abandonar el modo QUAD pulsando STWX.

h. Función zoom Pulse el botón del mando a distancia para ampliar o reducir el vídeo de la cámara seleccionada. Puede mover el vídeo ampliado o reducido por medio de las ﬂechas STWX del mando a distancia o del monitor. Pulse de nuevo el botón del mando a distancia para restablecer el tamaño del vídeo inicial.

i. Calidad de la señal La calidad de recepción se representa por medio de unas barras situadas a la derecha del símbolo de la antena, que a su vez se encuentra en la parte superior izquierda de la pantalla. Cuanto mayor sea el número de barras, mejor será la calidad de la señal. Consulte la tabla que ﬁgura a continuación. Nivel de la señal

Velocidad

I/s en modo VGA

1062~1280Kbps

5~10Fps

15~30Fps

Bueno

725~1062Kbps

3~5Fps

12~20Fps

Regular

543~725Kbps

2~4Fps

8~15Fps

Bajo

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Muy bueno

Ausente

Representación

CFI EXTEL WESV 82600 - 10/2011 - V1

I/s en modo QVGA

(6

7. VISUALIZACIÓN EN UN PC

1

2

No utilice el cable RCA para este tipo de conexión.

ATENCIÓN

(6

Antes de conectar el receptor tiene que haber instalado en su PC el software suministrado.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. UTILIZACIÓN DEL KIT CON UN PC a. Instalación del software con el CD-ROM suministrado “GUARDING HOME EDITION Introduzca el CD-ROM suministrado en su lector de CD para instalar el software “GUARDING RECORDER”. Ejecución automática de la instalación

Marque su idioma y pulse » para continuar

Pulse » para continuar

Siga las instrucciones y pulse “OK”

Pulse “Siguiente” para continuar. Pulse “Examinar” para cambiar de carpeta.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

Registro de la licencia del software : Durante la instalación, introduzca el nombre y el código que ﬁgura en la funda del CDROM suministrado. Respete rigurosamente las minúsculas y las mayúsculas, así como la sintaxis del código : xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Conexión del monitor

2

Conecte el cable USB (incluido en el kit) al conector adaptado situado en la parte trasera del monitor y al puerto USB disponible de un PC. Tras la conexión, en la parte inferior izquierda del monitor aparece un mensaje que indica que el material está listo para ser usado. Haga doble clic en el icono que aparece en su escritorio.

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Presentación del software “ENREG PROTECTION”

F Añadir

el programa a la barra situada en la parte inferior izquierda - Reducir el programa en la barra de tareas x Cerrar el programa

Expansión de los menús

Indicador de las cámaras

1

2

3

4

5

6

7

8

1. Indicador de conexión de la cámara y de sonido 2. Ajustes de seguridad 3. Captura de vídeo 4. Fotografías 5. Lista de eventos 6. Conﬁguración de las pantallas 7. Acerca del software – Versión del software – Actualización – Registro de la licencia 8. Zoom /Panel de control de dirección

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

I - INDICADOR DE CONEXIÓN DE LA CÁMARA Y DE SONIDO

Indica la calidad de la señal de la cámara y que el sonido está activo Indica que no hay ninguna cámara conectada y que el sonido no está activo

II - AJUSTES DE SEGURIDAD

a. Detección de movimiento Puede utilizar su sistema de videovigilancia como sistema de alarma. Un movimiento en el campo de la cámara activará una alarma y una grabación en función de los parámetros conﬁgurados. Nivel de sensibilidad Ajuste de 0 a 100 Ajuste de la duración de la alarma

Ajuste de alarma sola o de alarma y grabación: cada vez que se detecta un movimiento, se efectuará una grabación en la carpeta seleccionada por el usuario. Guardar los ajustes Capítulo a. Capítulo b. Capítulo c.

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programación de los eventos de grabación Programación 24h

Segmentación por sección de 2h Selección del tipo de evento Selección de la cámara afectada por el tipo de evento

Selección de la resolución Selección del formato de grabación tras una detección (videoclip o foto) Haga clic en este icono para guardar los ajustes

: permite grabar un vídeo en la franja horaria indicada. El vídeo se graba directamente en la carpeta seleccionada por el usuario (ver capítulo siguiente). : la detección de movimiento activa una grabación vídeo o la captura de una serie de fotos. Sólo se grabará un ﬂujo vídeo (1 sola cámara a la vez).

c. Selección del directorio de grabación Para seleccionar el directorio de grabación haga clic en el icono de carpeta de color amarillo. Puede cambiar la carpeta de grabación.

Conﬁguración del tiempo que permanece guardado un archivo. Por ejemplo: 7 días o menos. Si selecciona esta opción, los archivos no se eliminarán. Haga clic en este icono para guardar los ajustes.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

III - CAPTURA VÍDEO Selección de un directorio de grabación Supresión del vídeo anteriormente grabado

1. Grabación del vídeo visualizado en pantalla. Durante la grabación aparecerá un punto rojo en la pantalla. 2. Ralentización del vídeo en modo lectura hasta 16 veces. 3. Lectura del vídeo grabado. 4. Aceleración del vídeo en modo lectura hasta 10 veces. 5. Parada del vídeo durante el modo lectura.

1

2

3

4

5

IV - FOTOGRAFÍAS

1

2

3

4

5

6 1. Haciendo clic en el icono, podrá hacer una foto de la imagen que aparece en pantalla (las fotos se graban temporalmente en la zona inferior). 2. Graba las fotos realizadas en la carpeta que usted quiera. 3. Elimina las fotos, de las más recientes a las más antiguas. 4. Guarda todas las fotos indicadas en la zona inferior en el directorio que usted quiera. 5. Elimina todas las fotos indicadas en la zona inferior. 6. Imprime las fotos que se seleccionan en la zona inferior.

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LISTA DE EVENTOS 1

2

3

4

5

1. Clasiﬁca las capturas por el nombre de la cámara 2. Clasiﬁca las capturas por orden cronológico 3. Clasiﬁca las capturas por tipo (foto o videoclip) 4. Eliminación de una captura 5. Eliminación de todas las capturas de imagen y vídeo

indica la fecha y la hora de una alarma por detección y grabación vídeo en formato “avi”. Al seleccionar el archivo de vídeo, aparece un panel de control:

- Ralentización del vídeo en modo lectura hasta 16 veces - Reproducción del vídeo grabado - Aceleración del vídeo en modo lectura hasta 10 veces - Parada del vídeo durante el modo lectura

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

indica la fecha y la hora de una alarma por detección y captura de fotos.

La carpeta de grabación es diferente para cada tipo de evento. El programa guarda en la carpeta de grabación seleccionada los diferentes grupos de eventos según su función.

Carpeta para alarma con detección programada Carpeta para captura vídeo programada Carpeta videoclip controlada por el usuario

(6

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURACIÓN DE LAS PANTALLAS

Haga clic en el icono Capítulo a. Capítulo b. Capítulo c.

Aparecerá el siguiente menú

a. Dispo. : no utilizado

b. Pantallas Registro de fecha y hora: Muestra u oculta la hora y la fecha.

Nombre cámara: Muestra u oculta el nombre de la cámara. Permite designar las cámaras.

Importante: Haga clic en este icono para guardar.

c. Idioma

Selección del idioma del software.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

VII - ACERCA DEL SOFTWARE - VERSIÓN DEL SOFTWARE

Haga clic en el icono

1-Indica la versión del software. 2-Indica la activación del software (registro de la licencia). 3-Comprueba las actualizaciones del software vía Internet (no utilizado).

VIII - ZOOM / PANEL DE CONTROL DE DIRECCIÓN

Visualización normal

(6

Modo zoom activo (las ﬂechas se vuelven válidas)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. MANTENIMIENTO La garantía quedará anulada si desmonta las piezas usted mismo. Limpie la parte externa sólo con un paño seco y suave. Antes de proceder a la limpieza, desenchufe el sistema de videovigilancia. ATENCIÓN: No utilice ningún producto de limpieza a base de ácido carboxílico, alcohol o similares. Además de poder deteriorar el aparato, los vapores que desprenden son explosivos y peligrosos para su salud. No utilice ningún utensilio que pueda ser conductor de corriente (cepillo metálico, utensilio punzante, etc.) para la limpieza.

10. REPARACIÓN Con este sistema de videovigilancia ha adquirido un producto de última tecnología y listo para ser usado. Todas las piezas que se suministran le permitirán utilizar el kit satisfactoriamente. No obstante, si detecta algún problema o defecto de funcionamiento, podrá solucionarlos leyendo la tabla siguiente: Avería

Causa

Solución

El receptor no se enciende

Problema de alimentación

Comprobar la conexión del adaptador

Ausencia de imagen e indicación “ausencia de señal”

• La cámara no está alimentada • La cámara no está emparejada • El receptor no recibe la señal

• Comprobar la conexión del adaptador • Consultar el Capítulo 6. c. • Acercar la cámara y encontrar un lugar más adecuado

Imposible visualizar las cámaras adicionales

Las cámaras no han sido validadas en el receptor

Consultar el Capítulo 6. d.

El mando a distancia no funciona

• Si se trata de la 1ª utilización, retirar la protección transparente de la pila • Cambiar la pila

En caso de necesidad, nuestro sitio técnico www.cﬁ-extel.com se encuentra a su disposición Asistencia técnica : +34 902 109 819 sat-hotline@cﬁ-extel.com CFI EXTEL WESV 82600 - 10/2011 - V1

(6

11. INSTRUCCIONES DE SEGURIDAD Los daños ocasionados por no respetar el manual de instrucciones conducirán a la anulación de la garantía. EXTEL no se responsabilizará de los daños que resulten de esta falta de conformidad. Tampoco se responsabilizará de los daños que puedan sufrir los bienes o las personas por la incorrecta manipulación del sistema o el incumplimiento de las instrucciones de seguridad. Este producto se ha fabricado en el más absoluto respeto de las instrucciones de seguridad. Para garantizar este estado y optimizar la utilización del producto, el usuario debe respetar las instrucciones y advertencias de seguridad contenidas en este manual. El usuario de este sistema tendrá que responsabilizarse de este último y deberá comprobar que la videovigilancia está permitida por la ley vigente en el país de utilización.

ATENCIÓN

Avisa al usuario de la presencia de instrucciones importantes relativas al mantenimiento (la reparación) en la documentación que acompaña al aparato.

Avisa al usuario de la presencia de “tensiones peligrosas” no aisladas dentro de la caja del producto y suﬁcientemente importantes como para representar un riesgo de electrocución para las personas.

Este símbolo indica un riesgo de choque eléctrico o un riesgo de cortocircuito. Sólo podrá utilizar este producto con una tensión comprendida entre: 100 240 voltios y 50 60 hertzios. Nunca intente utilizar este aparato con una tensión diferente. - Compruebe que todas las conexiones eléctricas del sistema sean conformes a las instrucciones de uso. - Si este sistema se instala en establecimientos comerciales, habrá que respetar las normas de prevención de accidentes para las instalaciones eléctricas. - Si se instala en establecimientos escolares, talleres, etc., será necesaria la presencia de personal cualiﬁcado para controlar el funcionamiento de los aparatos electrónicos. - Respete las instrucciones de uso de los demás aparatos conectados al sistema (vídeo, TV, PC por ejemplo). - En caso de tener dudas sobre el modo de funcionamiento o la seguridad de los aparatos, póngase en contacto con una persona cualiﬁcada. - Nunca enchufe o desenchufe los aparatos eléctricos con las manos mojadas. - Cuando instale este producto, compruebe que los cables de alimentación no corren el riesgo de ser dañados. - ¡Nunca cambie los cables eléctricos dañados usted mismo! En tal caso, sáquelos y recurra a una persona cualiﬁcada para que los sustituya. (6

CFI EXTEL WESV 82600 - 10/2011 - V1

12. INFORMACIÓN FCC/CE Observación: Este equipo ha sido sometido a las pruebas de rigor y se ha verificado su conformidad con los límites establecidos para un dispositivo de Clase B, de acuerdo con las normas europeas en vigor. Estos límites se han concebido para ofrecer una protección razonable contra las interferencias perjudiciales en las instalaciones residenciales. Este equipo genera, usa y puede irradiar energía de radiofrecuencia y, si no se instala y usa de acuerdo con las instrucciones, puede provocar interferencias perjudiciales en las comunicaciones de radiofrecuencia. Sin embargo, no hay ninguna garantía de que no se produzcan interferencias en una instalación concreta. Si este equipo causara interferencias perjudiciales en las recepciones de radio o televisión, lo cual puede determinarse encendiendo y apagando el equipo, se aconseja al usuario que trate de corregir las interferencias adoptando al menos una de las siguientes medidas: • Reorientar o cambiar de lugar la antena receptora. • Incrementar la separación entre el equipo y el receptor. • Conectar el equipo a una toma de corriente que esté en un circuito diferente al que está conectado el receptor.

Notificación FCC/CE Deberán cumplirse ciertas reglas: Los aparatos que utilizan ondas radio tendrán que ser obligatoriamente conformes a las reglas y a los reglamentos. Como tales, la potencia del emisor estará limitada. Un receptor no podrá responder a más de una señal a la vez, por lo que podrá verse perturbado por señales radio próximas a sus frecuencias de funcionamiento.

CFI EXTEL WESV 82600 - 10/2011 - V1

(6

SUMÁRIO

............. p.14

1 INSTRUÇÕES DE SEGURANÇA .....p.3

7 VISUALIZAÇÃO NUM PC

2 COMPOSIÇÃO DO KIT ......................p.4

8 UTILIZAÇÃO DO KIT COM UM PC ...

3 CARACTERÍSTICAS TÉCNICAS .... p.4

a. Especiﬁcidades técnicas b. Caixa receptora c. Câmara (SVCM 82501) 4 INSTALAÇÃO DA CÂMARA ...........p.6 a. Descrição da câmara b. Instalação da câmara c. Fixação do suporte câmara d. Conexão da câmara e. Iluminação infravermelha f. Câmaras suplementares g. Aparelhamento da ou das câmaras 5 INSTALAÇÃO DO RECEPTOR... .....p.8 a. Descrição do receptor b. Instalação do receptor c. Conexão caixa receptora a uma TV ou um monitor 6 FUNÇÃO E UTILIZAÇÃO DO KIT

.................................................................. p.10 a. Colocação em serviço b. Conexão das câmaras c. Associar a câmara ao receptor d. Visualização da câmara ou das câmaras e. Regulação do volume sonoro f. Função Scan Time ou QUAD g. Regulação ecrã h. Função zoom i. Qualidade do sinal

37

........................................................... p.15 a. Installation software avec cd-rom fourni «GUARDING HOME EDITION» b. Conexão do monitor c. Apresentação do software «Enreg. protection» I - INDICADOR DE CONEXÃO CÂMARA E SOM II - REGULAÇÕES DE SEGURANÇA a. Detecção de movimento: b. Programação dos acontecimentos de registo c. Programação directório de registo III - CAPTURA VÍDEO IV - FOTOGRAFAR V - LISTA ACONTECIMENTOS VI - CONFIGURAÇÃO DA VISUALIZAÇÃO a. Device: não utilizado b.Visualização (Display) c. Línguas (Language) VII - A PROPÓSITO ? VERSÃO SOFTWARE VIII - ZOOM / PAINEL DE CONTROLO DE DIRECÇÃO 9 MANUTENÇÃO .............................. p.25 10 REPARAÇÃO ................................... p.25 11 INSTRUÇÕES DE SEGURANÇA 12 ADVERTÊNCIA FCC/CE

CFI EXTEL WESV 82600 - 10/2011 - V1

. p.26

................. p.27

CONFIGURAÇÃO MÍNIMA

Processador de pelo menos 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB Memória RAM recomendada 1 GB de espaço livre no disco rígido Monitor de cores com placa vídeo 16 bits mínimo Resolução do monitor 1024x768 min 96 dpi Placa Gráﬁca compatível Microsoft Direct X9 ou superior Leitor CD-ROM para a instalação do software Um porto USB livre (1.1 ou superior) Software unicamente compatível com este kit.

1. INSTRUÇÕES DE SEGURANÇA Importante ! • Leia o manual de utilização com cuidado antes de instalar ou utilizar este produto. • Se instalar este produto para outros, pense em deixar o manual ou uma cópia ao utilizador ﬁnal. Advertência: • Os diferentes elementos deverão ser desmontados apenas por um técnico autorizado. Medidas de segurança: • Para uma exploração em completa segurança deste sistema, é essencial que os instaladores, utilizadores e técnicos respeitem todos os procedimentos de segurança descritos neste manual. • Advertências especíﬁcas e símbolos de atenção são indicados nos elementos se necessário. O utilizador deste produto é responsável e deve veriﬁcar se a utilização que será feita está conforme à lei em vigor para a videovigilância no país de utilização IMPORTANTE (Em França: Informar-se junto da prefeitura do seu departamento Fora da França: Informar-se junto das autoridades competentes em matéria de utilização de produtos de videovigilância (Direcção das liberdades públicas, Gabinete da regulamentação geral…)

Embora digitais, as câmaras são sujeitas à interferência dos telefones sem ﬁos, dos microondas e outros dispositivos sem ﬁos que funcionam em 2,4 GHz (WIFI por exemplo). Mantenha o sistema a mais de 3 m dos dispositivos durante a instalação e a utilização. CFI EXTEL WESV 82600 - 10/2011 - V1

37

2. COMPOSIÇÃO DO KIT

FkPDUDVHPÀRV*+] FDL[DUHFHSWRUD*+] VXSRUWHSDUDRUHFHSWRU DGDSWDGRUHVGH9'&SDUDDFkPDUDHRUHFHSWRU VDFRGHSDUDIXVRV FDER5&$-DFNSDUDVDtGDÉXGLR9tGHR FDER86% &'VRIWZDUHGHYLGHRYLJLOkQFLDSDUD3& PDQXDOGHXWLOL]DomR

3. CARACTERÍSTICAS TÉCNICAS D(VSHFLÀFLGDGHVWpFQLFDV 5)HVSHFLÀFDomR )UHTXrQFLDUiGLR*+] 0RGXODomRQXPpULFD*)6.)UHTXHQF\+RSSLQJ6SUHDG6SHFWUXP $QWLLQWHUIHUrQFLD 'pELWRGHIUHTXrQFLD0ESV $PSOLWXGHGHEDQGDGHFDGHLD0+]

37

CFI EXTEL WESV 82600 - 10/2011 - V1

E&DL[DUHFHSWRUD &RQVXPRP$ &DQDLV )UHTXrQFLDGHUHFHSomR*+] 'LPHQV}HV´[[PP µ 3HVRJUDPDV 7HPSHUDWXUDGHXWLOL]DomR&D&DSUR[LPDGDPHQWH $9287&RQH[}HV-DFNiXGLRYtGHR7RPDGR-DFNPP 3&287&RQH[mR86%

F&kPDUD69&0 $OLPHQWDomR9'& &RQVXPRP$ &DQDLV 7UDQVPLVVmRGHIUHTXrQFLD*+] 6HQVLELOLGDGHjOX]OX[ SUHYHUXPDLOXPLQDomRVXSOHPHQWDUSDUDDQRLWH LOXPLQDomRLQIUDYHUPHOKDGtRGRV,QIUDYHUPHOKRV 3HVRVHPVXSRUWH J 7GHIXQFLRQDPHQWR&D&DSUR[LPDGDPHQWH 'LPHQV}HV[[PP 5HVROXomR[St[HLVDLPDJHQVV ÇQJXORGHYLVmR /LJDomRGLJLWDOHQWUHDFkPDUDHRUHFHSWRUHVWDWHFQRORJLDOLPLWDDVLQWHUIHUrQFLDVH DVSHUWXUEDo}HVQDOLJDomR $OFDQFHDSUR[LPDGDPHQWHPHPFDPSROLYUH

CFI EXTEL WESV 82600 - 10/2011 - V1

37

4. INSTALAÇÃO DA CÂMARA

ATENÇÃO

Assegurar-se de que nenhum elemento diﬁculta a inserção dos parafusos no muro.

a. Descrição da câmara 1 2

11

10

3

4 7

3

8

9

12 13

14 6

1. Antena orientável a aparafusar nas costas da câmara. 2. Protecção das câmaras (IP 44). 3. Objectivo da câmara. 4. Parafuso para ﬁxar a posição da câmara. 5. Suporte da câmara. 6. Micro (na parte vazia da caixa). 7. Tomada para conectar o adaptador. 8. Célula para activar os díodos IR, na obscuridade. 9. Díodo infravermelho (iluminação não visível). 10. Sinal luminoso vermelho, conﬁrma a alimentação da câmara. 11. Sinal luminoso verde, assinala que a câmara é visualizada no monitor. 12. Parafuso de ﬁxação para o arco. 13. Botão para associar a câmara com o seu monitor: “pairing key”. 14. Adaptador 5 VDC (ﬁcha curvada).

b. Instalação da câmara Escolha um lugar adequado para a instalação da câmara. Na medida do possível o seu sistema deve ser instalado num lugar sem poeira, com fracas vibrações e uma boa circulação do ar e ser equipado de uma tomada mural para o adaptador 5 VDC. Na instalação da câmara, veriﬁque a boa recepção das imagens no monitor antes da instalação ﬁnal. Faça por exemplo manter por alguém a câmara no sector a supervisionar. Faça deslocar por outra pessoa o monitor em diferentes lugares na casa para controlar a boa recepção. Se encontrar interferências ou outros problemas, agradecemos que consulte o capítulo “Manutenção”. 37

CFI EXTEL WESV 82600 - 10/2011 - V1

Montagem dos diferentes elementos que compõem a câmara (A), tem a possibilidade de deslocar o arco de ﬁxação da câmara (B) se tiver de posicionar o apoio orientável no tecto (C).

A

B

C

c. Fixação do suporte câmara • Assegure-se de que nenhum elemento diﬁculta a instalação. • Procure um lugar adequado para ﬁxar o suporte. • Aparafuse a parte mural com os parafusos fornecidos. (Utilizar cavilhas se necessário). • Aparafuse a câmara no suporte. • Aponte a câmara na direcção desejada e aperte o parafuso lateral de suporte.

d. Conexão da câmara 1. Ligue o cordão do adaptador 5VDC na ﬁcha “Alimentação” da câmara. 2. Ligue o adaptador numa tomada 230 VAC (o sinal luminoso vermelho acende-se).

CFI EXTEL WESV 82600 - 10/2011 - V1

37

e. Iluminação infravermelha Os díodos infravermelhos não produzem luz visível a olho nu. A iluminação infravermelha activa-se automaticamente na obscuridade.

f. Câmaras suplementares Tem a possibilidade de completar a sua instalação com câmaras suplementares (o receptor aceita até 4 câmaras).

g. Aparelhamento da ou das câmaras A câmara fornecida com o conjunto já está aparelhada, cada câmara suplementar deve “ser associada igualmente” ao receptor. Se não é o caso, consulte o capítulo 6-c “Associar a câmara ao receptor”.

5. INSTALAÇÃO DO RECEPTOR Instale o receptor a aproximadamente 1m acima do solo (para condições de recepção óptimas). Para a instalação do receptor, escolha um lugar afastado dos muros de betão armado, espelhos, estantes de metal, etc.… Afaste o receptor dos aparelhos que criam interferências eléctricas fortes. Qualquer ambiente eléctrico forte pode causar interferências e perturbar a utilização (WIFI em especial).

a. Descrição do receptor

1

9

12 11 13

2 M

3

4 5 6

14

7

37

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Antena orientável a aparafusar nas costas do receptor. 2. Saída Áudio/Vídeo na tomada miniJack. 3. Entrada de alimentação 5VDC. 4. Sinal luminoso de actividade câmara. • se é verde nenhuma câmara está aparelhada. • se estiver apagado pelo menos uma câmara está aparelhada. 5. Sinal luminoso pisca vermelho durante o cálculo de aparelhamento de uma câmara, em seguida apaga-se a partir do registo da câmara. 6. Sinal luminoso verde que confirma a alimentação do receptor. 7. Adaptador 5 VDC. 8. Cabo Áudio/Vídeo. 9. Suporte caixa receptora. 10. Cabo USB. 11. Tomada USB. 12. Bloco direccional STWX botão “M” que permite visualizar o menu (via TV). 13. Botão permite fazer um zoom no vídeo. 14. Botão permite aparelhar e seleccionar as câmaras.

b. Instalação do receptor

Faça deslizar o suporte no carril adequado.

ATENÇÃO

Colocar unicamente o receptor sobre superfícies duras e estáveis.

CFI EXTEL WESV 82600 - 10/2011 - V1

37

c. Conexão caixa receptora a uma TV ou um monitor

2 1 Audio

Video

Não utilizar o cabo USB para este tipo de ligação.

No caso de uma má imagem, veriﬁcar se o formato do sinal vídeo escolhido é compatível com o seu ecrã. 1. Os aparelhos fora de tensão 2. Conectar os dois aparelhos através do cordão RCA/Jack fornecido 3. Conectar o cabo mini Jack na parte traseira do receptor na saída AV out e as extremidades RCA amarelo (vídeo) e branco (áudio). (Ver imagem acima) 4. Ligar o cordão do adaptador 5VDC na ﬁcha “alimentação” do receptor. 5. Ligue o adaptador numa tomada de corrente 230 VAC: o sinal luminoso x ilumina-se em verde. 6. Colocar sob tensão o monitor

6. FUNÇÃO E UTILIZAÇÃO DO KIT a. Colocação em serviço Prima a tecla

Marcha Paragem (utilize esta mesma tecla para parar a caixa receptora).

b. Conexão das câmaras 1- Ligue o cordão do adaptador 5VDC na entrada “alimentação” da câmara. 2- Ligue o adaptador numa tomada de corrente.

37

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Associar a câmara ao receptor Na ocasião da primeira colocação em serviço a câmara contida no conjunto já está aparelhada. No caso contrário ou para acrescentar outra câmara proceder como abaixo: Prima a tecla “M” da caixa receptora e ir para o menu “PAIR CAM” com a tecla T. Escolher um canal livre entre 1, 2, 3 e 4 com as teclas W e X . Premir a tecla para lançar o registo. Tem 60 segundos para aparelhar a câmara. Levantar o resguardo situado na parte traseira da sua câmara em seguida introduzir o botão “Pairing key” através de um objecto pontiagudo (por exemplo clipe). Só um canal por câmara pode ser activado no receptor. No caso de várias câmaras, deve escolher 1 canal diferente para cada câmara.

d. Visualização da câmara ou das câmaras Para visualizar uma ou várias câmaras (se instalou câmaras suplementares), utilizar a tecla . Atenção, no caso de várias câmaras, deve assegurar-se de que estão parametrizadas em visualização no menu. Para isso, premir a tecla “M” do receptor, e assegurar-se de que os canais das câmaras registadas estão no estado “ON”. Exemplo: “CAM ON” Para alterar, seleccionar o canal com a tecla T e alterar o estado com as teclas W e X . As câmaras em posição “OFF” não estarão visíveis no desﬁle manual ou automático. O número na parte superior à esquerda do ecrã indica a câmara seleccionada.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

37

e. Regulação do volume sonoro Premir a tecla “ok” um menu aparece:

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Aumentar ou reduzir o som com as teclas W e X do monitor.

f. Função Scan Time ou QUAD (a utilizar apenas no caso de várias câmaras)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

37

Premir o botão “M” do receptor. Em “SCAN TIME” com as teclas W e X, seleccionar o tempo de desﬁle (5,10, 15, 20 segundos) ou Visualização em modo QUAD.

(Recapitulativo: só as câmaras em modo de visualização “ON” serão visíveis, ver parágrafo d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

A câmara 1 na parte superior à esquerda do ecrã A câmara 2 na parte superior à direita do ecrã A câmara 3 na parte inferior à esquerda do ecrã A câmara 4 na parte inferior à direita do ecrã

Ecrã preto para as câmaras não conectadas ou não activadas (OFF). CH3

CH4

A Notar: em modo QUAD as teclas “M”, do modo QUAD premindo em S TW X .

e

não estão activas. Deve primeiro sair

h. Função zoom Premir o botão do telecomando para fazer um zoom no vídeo da câmara seleccionada. Tem a possibilidade de deslocar o vídeo com zoom através das setas S TW X do telecomando ou do monitor. Premir outra vez neste mesmo botão para reencontrar o vídeo inicial.

i. Qualidade do sinal A qualidade de recepção é representada por barras à esquerda do símbolo antena na parte superior à esquerda do vídeo. Quanto maior for o número de barras melhor é qualidade do sinal. Ver quadro abaixo. Nível do sinal

Débito

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

725~1062Kbps

3~5Fps

12~20Fps

Médio

543~725Kbps

2~4Fps

8~15Fps

Baixo

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Muito bom Bom

Ausente

Visualização

CFI EXTEL WESV 82600 - 10/2011 - V1

37

7. VISUALIZAÇÃO NUM PC

1

2

Não utilizar o cabo RCA para este tipo de ligação

ATENÇÃO

37

Deve obrigatoriamente ter instalado no seu PC o «software» fornecido antes de conectar o receptor.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. UTILIZAÇÃO DO KIT COM UM PC

a. Instalação «software» com CD-ROM fornece “GUARDING HOME EDITION” Inserir o CD-ROM fornecido no seu leitor CD para instalar o «software» “GUARDING RECORDER «. Arranque da instalação “Autorun”

Assinale a língua da sua escolha, Validar com »

Validar através de »

Siga as instruções « ok »

Clique em “Next” para continuar Cliquem em “Browse” para mudar de dossier

CFI EXTEL WESV 82600 - 10/2011 - V1

37

Registo licença «software»: Durante a instalação registar o nome e o código indicado na capa do CD-ROM fornecido, respeitar imperativamente as minúsculas e maiúsculas e a sintaxe do código: xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Conexão do monitor

2

Conectar o cabo USB (fornecido no kit) na ﬁcha adaptada na parte traseira do monitor e num porto USB disponível de um PC. A partir da ligação uma mensagem indica que o material está pronto a ser empregue na parte inferior à esquerda do monitor. Clique duas vezes no ícone aparecido no seu computador.

37

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Apresentação do «software» “ENREG PROTECTION”

Inserir o programa na barra inferior à esquerda - Reduzir o programa na barra de tarefas x Fechar o programa F

Extensão menus

Indicador das câmaras

1

2

3

4

5

6

7

8

1. Indicador de conexão câmara e de som 2. Regulações de segurança 3. Captura vídeo 4. Tomada foto 5. Lista dos acontecimentos 6. Conﬁguração da visualização 7. A propósito? Versão «software» – Actualização – Registo licença 8. Zoom/Painel de controlo direcção

CFI EXTEL WESV 82600 - 10/2011 - V1

37

I - INDICADOR DE CONEXÃO CÂMARA E SOM

Indica a qualidade do sinal câmara e os seus activos

Indica que não há câmara conectada e não hã som activo

II - REGULAÇÕES DE SEGURANÇA

a. Detecção de movimento Pode utilizar o seu sistema de videovigilância como sistema de alarme. Um movimento no campo da câmara desencadeará um alarme e um registo em função da conﬁguração que terá parametrizado. Nível de sensibilidade Regulação de 0 a 100 Regulação da duração do alarme

Regulação apenas do alarme ou alarme e registo: em cada detecção um registo efectuar-se-á no dossier parametrizado pelo utilizador Salvaguarda as regulações Capítulo a. Capítulo b. Capítulo c.

37

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programação dos acontecimentos de registo Parametrização em 24h

Segmentação por secção de 2h Escolha do tipo de acontecimento Escolha da câmara afectada por tipo de acontecimento Escolha da resolução Escolha do formato registado numa detecção (clip vídeo ou fotograﬁa) Clicar neste ícone para salvaguardar as regulações

: permite registar um vídeo numa zona horária indicada. O vídeo regista-se directamente no dossier escolhido pelo utilizador (ver capítulo seguinte). : uma detecção de movimento activa um início de ﬁlme ou um início série de fotograﬁas. Um só ﬂuxo vídeo regista-se (1 única câmara ao mesmo tempo).

c. Programação directório de registo Parametrização do directório de registo ao clicar no ícone dossier amarelo. Possibilidade de alterar o seu processo de registo.

Parâmetro de tempo de salvaguarda de um ﬁcheiro. Exemplo: 7 dias ou menos. Se validado, os ﬁcheiros são conservados. Clicar neste ícone para salvaguardar as regulações.

CFI EXTEL WESV 82600 - 10/2011 - V1

37

III - CAPTURA VÍDEO Escolha de um directório de registo Supressão do vídeo previamente registado

1. Registo do vídeo visualizado no ecrã Um ponto vermelho aparece então no ecrã 2. Afrouxamento do vídeo em modo leitura até/16 3. Leitura do vídeo registada 4. Aceleração do vídeo em modo leitura até x10 5. Paragem do vídeo durante o modo leitura

1

2

3

4

5

IV - FOTOGRAFAR

1

2

3

4

5

6 1.Ao clicar no ícone, permite fotografar a imagem apresentada no ecrã – as fotograﬁas registam-se de maneira temporária no rectângulo inferior 2. Registe as fotograﬁas feitas num dossier da sua escolha 3. Apaga as fotograﬁas a partir das mais recentes até às mais antigas 4. Registe todas as fotograﬁas indicadas no rectângulo num directório da sua escolha 5. Suprime todas as fotograﬁas indicadas no rectângulo 6.Imprime uma fotograﬁa seleccionada em destaque no rectângulo

37

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LISTA ACONTECIMENTOS 1

2

3

4

5

1. Trie as fotos por nome de câmara 2. Trie as fotos por antiguidade das datas 3. Trie as fotos por modo (tipo de vista) foto ou clip… 4. Supressão de uma foto 5. Supressão de todas as diferentes fotos e vídeos

indica a data e a hora de um alarme através de detecção e vídeo de formato “avi”. Ao seleccionar “em destaque” o ﬁcheiro vídeo um painel de controlo aparece:

- afrouxamento do vídeo modo leitura até/16 - leitura do vídeo registada - aceleração do vídeo em modo leitura até a x10 - paragem do vídeo durante o modo leitura

CFI EXTEL WESV 82600 - 10/2011 - V1

37

indica a data e a hora de uma através de detecção e tomada de alarme fotograﬁas.

Para cada função dos acontecimentos, o dossier de registo é diferente. O programa inscrito no dossier de registo seleccionado, cada associação diferente conforme a função.

Dossier para alarme com detecção programada Dossier para captura vídeo programada Dossier clip vídeo controlado pelo utilizador

37

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURAÇÃO DA VISUALIZAÇÃO

Clicar no ícone Capítulo a. Capítulo b. Capítulo c.

O menu seguinte aparece

a. App : não utilizado (Device)

b. Visualização (Display) Duração tampão: Visualiza ou esconde o relógio e a data Nome cam: Visualiza ou esconde o nome da câmara

Permite de nomear as câmaras

Importante: Clicar neste ícone para salvaguardar

c. Línguas (Language)

Selecção da «software».

CFI EXTEL WESV 82600 - 10/2011 - V1

língua

utilizada

para

o

37

VII - A PROPÓSITO? VERSÃO «SOFTWARE»

Clicar no ícone

1- Indicar a versão do «software» 2- Indicar a activação (registo licença) do «software» 3- Veriﬁcar actualizações do «software» através da Internet (não utilizado)

VIII - ZOOM/PAINEL DE CONTROLO DE DIRECÇÃO

Visualização normal

37

Modo zoom activo (as setas tornam-se então válidas)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. MANUTENÇÃO A garantia anula-se se desmontar as peças. Limpar o exterior apenas com um tecido seco e suave. Antes da limpeza, desligar ou colocar fora de tensão o sistema de videovigilância. ATENÇÃO: Não empregar nenhum produto ou gasolina de depuração carboxílico, álcool ou similar. Além de correr o risco de daniﬁcar o seu aparelho, os vapores são igualmente perigosos para a sua saúde e explosivos. Não empregar nenhum instrumento que pode ser condutor de tensão (escova de metal, instrumento pontiagudo… ou outro) para a limpeza.

10.REPARAÇÃO Com este sistema de videovigilância, comprou um produto de última tecnologia e que está pronto para ser utilizado. Todas as peças são fornecidas para poder utilizar o seu Kit plenamente. Contudo se encontrar problemas ou defeitos de funcionamento, pode remediar a estes defeitos lendo o quadro seguinte: Avaria

Causa

Solução

O receptor não se acende

Problema de alimentação

Veriﬁcar a ligação do adaptador

Não há imagem e indicação “não há sinal”

• A câmara não está alimentada • A câmara não está emparelhada • O sinal não é recebido pelo receptor

• Veriﬁcar a ligação do adaptador • Consultar o Capítulo 6. c. • Aproximar a câmara e encontrar um lugar mais adequado

Impossível visualizar as câmaras suplementares

As câmaras não são validadas no receptor

Consultar o Capítulo 6. d.

O telecomando não funciona

• Se primeira utilização, retirar a protecção pilha transparente • Substituir a pilha

Se necessário, o nosso sítio técnico está à sua disposição www.cﬁ-extel.com Serviço de apoio ao cliente : 707 201 138

CFI EXTEL WESV 82600 - 10/2011 - V1

37

11. INSTRUÇÕES DE SEGURANÇA Os danos provocados pela falta de conformidade com o manual conduzem à expiração da garantia. Não assumiremos nenhuma responsabilidade pelos danos que resultarem disso! Não assumiremos nenhuma responsabilidade relativa a qualquer dano, sobre os bens ou pessoas, causado por uma má manipulação ou falta de conformidade com as instruções de segurança. Este produto foi fabricado no respeito total das instruções de segurança. A ﬁm de manter este estatuto e de assegurar a melhor exploração do produto, o utilizador deve observar as instruções e advertências de segurança contidas neste manual. O utilizador deste sistema é responsável e deve veriﬁcar se o videovigilância está conforme com a lei em vigor no país de utilização.

ATENÇÃO

Adverte o utilizador da presença de instruções importantes relativas à utilização e à manutenção (a reparação) na documentação que acompanha o aparelho.

Adverte o utilizador da presença “de tensões perigosas “, não isoladas no interno da caixa do produto, de uma importância suﬁciente para representar um risco de electrocussão para as pessoas.

Este símbolo indica um risco de choque eléctrico ou um risco de curto-circuito. - Deve utilizar este produto apenas com uma tensão compreendida entre: 100-240 Volts e 50-60 hertz. Nunca tente utilizar este aparelho com uma tensão diferente. - Preste atenção para que todas as conexões eléctricas do sistema estejam conformes com as instruções de utilização. - Nos estabelecimentos comerciais, assegure-se de respeitar as regras de prevenção dos acidentes para as instalações eléctricas. - Nas escolas, os equipamentos de formação, as oﬁcinas… a presença de um pessoal qualiﬁcado é necessária para controlar o funcionamento dos aparelhos electrónicos. - Respeitar as instruções de utilização dos outros aparelhos ligados ao sistema. (videogravador, TV, PC por exemplo) - Contacte uma pessoa experiente se tiver dúvidas acerca do modo de funcionamento ou da segurança dos aparelhos. - Nunca ligar ou desligar os aparelhos eléctricos com as mãos molhadas. - Na instalação deste produto, veriﬁcar os cabos de alimentações mesmo se estes não podem ser daniﬁcados - Não substitua nunca os cabos eléctricos daniﬁcados você próprio! Neste caso, retire-os e contacte uma pessoa experiente.

37

CFI EXTEL WESV 82600 - 10/2011 - V1

12. ADVERTÊNCIA FCC/CE Observação: Este equipamento foi testado e revelado conforme com os limites de um dispositivo da Classe B, em conformidade com as normas europeias em vigor. Estes limites são concebidos para fornecer uma protecção razoável contra as interferências numa instalação residencial. Este equipamento, utiliza e pode emitir uma energia de frequência rádio e, se não for instalado e utilizado em conformidade com as instruções, pode provocar interferências nas comunicações rádio. Contudo, não há nenhuma garantia que as interferências não se produzirão em uma instalação específica. Se este equipamento provoca interferências na recepção rádio ou TV o que pode ser determinado pondo o equipamento em marcha ou paragem, o utilizador é incentivado a rectificar as interferências adoptando pelo menos uma das medidas seguintes: • Reorientar ou deslocar a antena receptora • Aumentar a distância entre o equipamento e o receptor • Ligar o equipamento numa tomada que pertence a um circuito diferente que aquele ligado ao receptor

Notificação FCC/CE Algumas regras devem ser observadas: Os aparelhos que utilizam ondas rádio são obrigatoriamente conformes com as regras e os regulamentos. Como tais, a potência do emissor é limitada. Um receptor não pode responder a mais de um sinal ao mesmo tempo e pode por conseguinte ser perturbado por sinais rádio próximos das suas frequências de funcionamento.

CFI EXTEL WESV 82600 - 10/2011 - V1

37

SUMMARY

1 SAFETY INSTRUCTIONS

.................p.3

2 COMPOSITION OF THE KIT

...........p.4

3 TECHNICAL SPECIFICATIONS ........

.....................................................................p.4 a. Technical speciﬁcations b. Receiver c. Camera (SVCM 82501) 4 INSTALLING THE CAMERA

............p.6

a. Description of the camera b. Installing the camera c. Fixing the camera bracket d. Connecting the camera e. Infrared lighting system f. Additional cameras g. Pairing the camera(s) 5 INSTALLING THE RECEIVER... ........p.8 a. Description of the receiver b. Installing the receiver c. Connecting the receiver to a TV or a monitor

7 DISPLAY ON A PC

............................ p.14

......... p.15 a. Installing the software with the CD-ROM supplied “GUARDING HOME EDITION” b. Connecting the receiver c. Presentation of the software “Enreg. protection”

8 USING THE KIT WITH A PC

I - INDICATOR OF CAMERA CONNECTION AND SOUND II – SAFETY SETTINGS a. Motion detection b. Programming recording events c. Programming recording directory III - VIDEO CAPTURE IV - TAKING PICTURES V - LIST EVENTS VI - CONFIGURATION OF THE DISPLAY a. Device b. Display c. Languages VII - ABOUT? SOFTWARE VERSION VIII -ZOOM / DIRECTION CONTROL PANEL 9 MAINTENANCE .............................. p.25 10 TROUBLESHOOTING ................... p.25

6 FUNCTION AND USE OF THE KIT ...

.................................................................. p.10 a. Commissioning b. Connecting the cameras c. Associate the camera to the receiver d.Viewing the camera or the cameras e. Setting the sound volume f. Scan Time or QUAD function g. Screen setting h. Zoom function i. Quality of the signal

*%

11 SAFETY INSTRUCTIONS

.............. p.26

12 FCC/CE WARNING ........................... p.27

CFI EXTEL WESV 82600 - 10/2011 - V1

MINIMUM REQUIREMENTS

Processor at least 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB RAM recommended 1 GB hard disk free space Colour monitor with 16-bit video card minimum Monitor resolution 1024x768 min 96 dpi Graphics card compatible with Microsoft Direct X9 or higher CD-ROM driver for installing the software One free USB port (1.1 or higher) Software only compatible with this kit.

1. SAFETY INSTRUCTIONS Important ! • Please read the user manual thoroughly before installing or using this product. • If you install this product for other people, please give the manual or a copy to the end user. Warning :

• The different elements can only be dismantled by an authorised technician. Safety instructions : • To safely use this system, it is essential the ﬁtters, users and technicians follow the safety procedures described in this manual. • Speciﬁc warnings and caution symbols are indicated on the elements if necessary. The user of this product is responsible and must check that it will be used in accordance with the law applicable the video surveillance in the country of use. IMPORTANT (In France: Ask the prefecture of your department Outside France: Ask the authorities competent in the ﬁeld of video surveillance product use (Public Freedom Department, General Regulation Department…)

Even if they are digital, the cameras are subject to interference of wireless phones, microwave ovens and other wireless appliances operating on 2.4 GHz (WIFI for example). Keep the system at more than 3 m of the appliances during installation and use. CFI EXTEL WESV 82600 - 10/2011 - V1

*%

2. COMPOSITION OF THE KIT

• One 2.4 GHz wireless camera • One 2.4 GHz receiver • One bracket for the receiver • Two 5VDC adaptors for the camera and the receiver • One bag of screws • One RCA-Jack cable for Audio/Video output • One USB cable • One CD,Video surveillance software for PC • One user manual.

3. TECHNICAL SPECIFICATIONS a. Technical speciﬁcations RF speciﬁcation Radio frequency 2,402-2,454 GHz GFSK digital modulation: Frequency Hopping Spread Spectrum Anti-interference Frequency output: 2Mbps Chain bandwidth: 2MHz

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Receiver Power supply: 5 VDC. Power consumption: 300 mA. Channels: 4. Receiving frequency: 2,402-2,454 GHz. Dimensions: “85 x 82 x 25 (mm)”. Weight: 140 grams. Operating temperature: -10°C to + 50° approx. AV OUT: Audio/video Jacks connections: 3.5 mm jack plug. PC OUT: USB connection

c. Camera (SVCM 82501) Power supply: 5 VDC. Power consumption: 1000 mA. Channels: 4. Frequency transmission: 2,402-2,454 GHz. Light sensitivity: 1-8 lux* (* Use an additional lighting system overnight). Infrared lighting system: 24 infrared diodes. Weight (without bracket): 240 g. Operating temperature: -10°C to 40° approx. Dimensions: 164 x 64 x 42 (mm). Resolution: 640 x 480 pixels at 25 frames/s. Viewing angle: 53°. Digital link between the camera and the receiver (this technology limits interference and disturbances in the link). Range: approximately 150 m in free ﬁeld.

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

4. INSTALLING THE CAMERA

CAUTION

Be sure any element does not avoid inserting the screws in the wall.

a. Description of the camera 1 2

11

10

3

4 7

3

8

9

12 13

14 6

1. Adjustable antenna to be screwed at the back of the camera. 2. Protection of the cameras (IP 44). 3. Lens of the camera. 4. Screw to ﬁx the position of the camera. 5. Camera bracket. 6. Microphone (in the empty part of the housing). 7. Plug to connect the adaptor. 8. Cell to activate the IR diodes, in the darkness. 9. Infrared diode (non visible lighting system) 10. Red light indicator, conﬁrming the power supply of the camera. 11. Green light indicator, indicates that the camera is displayed on the monitor. 12. Fixing screw for the U-bolt 13. Button to associate the camera with its monitor: “pairing key”. 14. 5 VDC Adaptor (angle plug).

b. Installing the camera Choose a suitable location to install the camera. As far as possible your system must be installed in a dust-free place with weak vibrations and a good circulation of air and must be equipped with a wall socket for the 5 VDC adaptor. When installing the camera, check the good reception of the images on the monitor before the ﬁnal installation. For example ask another person to hold the camera in the area to control. Ask another person to move the monitor to different places in the house to check the good reception. If you ﬁnd some interference or other problems, please refer to the chapter “Maintenance”. *%

CFI EXTEL WESV 82600 - 10/2011 - V1

Assembly of the different elements composing the camera (A), you have the possibility to move the U-bolt of the camera (B) if you have to position the adjustable bracket to the ceiling (C).

A

B

C

c. Fixing the camera bracket • Make sure that no element interferes with the installation. • Search for a suitable place to ﬁx the bracket. • Screw the wall part with the supplied screws. (Use bushings if necessary). • Screw the camera on the bracket. • Aim the camera at the desired direction and tighten the side retaining screw.

d. Connecting the camera 1. Connect the cord of the 5VDC adaptor to the “Power supply” plug of the camera. 2. Plug the adaptor into a 230 VAC outlet (the red indicator lights up).

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

e. Infrared lighting system The infrared diodes do not produce light visible to the naked eye. The infrared lighting system activates automatically in the darkness.

f. Additional cameras You have the possibility to complete your installation with additional cameras (the receiver accepts up to 4 cameras).

g. Pairing the camera(s) The camera supplied with the kit is already paired, each additional camera must also be “associated” to the receiver. If not, refer to the chapter 6-c “Associate the camera to the receiver”.

5. INSTALLING THE RECEIVER. Install the receiver at approximately 1 m above the ground (for optimum reception conditions). For installing the receiver, choose a location away from reinforced concrete walls, mirrors, metallic shelves, etc… Keep the receiver away from all appliances creating strong electrical interference. Any strong electrical environment may cause disturbances and interferes with the use (WIFI in particular).

a. Description of the receiver 1

9

12 11 13

2 M

3

4 5 6

14

7

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Adjustable antenna to screw at the back of the receiver. 2. Audio/Video output on mini-jack. 3. 5VDC power supply input. 4. Camera activity light indicator • if it is green no camera is paired. • if it is turned off ay least one camera is paired. 5.The light indicator blinks red during the pairing countdown of a camera, and then turns off once the camera registered. 6. Green light indicator conﬁrming the power supply of the receiver. 7. 5 VDC adapter. 8. Audio/Video cable 9. Receiver bracket. 10. USB cable. 11. USB plug. 12. Directional pad STWX button “M” allows displaying the menu (via TV). 13. The button allows zooming in the video. 14. Button allows pairing and selecting the cameras.

b. Installing the receiver

Slide the bracket in the relevant rail.

CAUTION

Only place the receiver on stable and hard surfaces.

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

c. Connecting the receiver to a TV or a monitor

2 1 Audio

Video

Do not use the USB cable for this type of connection.

In case of a band quality image, check that the format of the video signal selected is compatible with your screen. 1. The appliances turned off 2. Connect the two appliances with the supplied RCA/Jack cord 3. Connect the mini jack cable at the back of the receiver to the AV output and the RCA yellow (video) and white (audio) terminal ends. (See picture below) 4. Connect the cord of the 5VDC adaptor to the “power supply” plug of the receiver. 5. Plug the adaptor into a 230 VAC mains socket: the light indicator turns on green. 6. Turn on the monitor

6. FUNCTION AND USE OF THE KIT a. Commissioning Press the key

ON/OFF (use this same key to turn the receiver off).

b. Connecting the cameras 1- Connect the cord of the 5VDC adaptor to the “Power supply” input of the camera. 2- Plug the adaptor into a mains socket.

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Associate the camera to the receiver For the ﬁrst use, the camera included in the kit is already paired. If not or to add another camera, proceed as follows: Press the key “M” of the receiver and go to the “PAIR CAM” menu with the key T. Select a free channel between 1, 2, 3 and 4 with the keys W and X . Press the key to start registering. You have 60 seconds to pair the camera. Open the cover located at the back of the camera and then press the button “Pairing key” with a sharp object (for example a paper clip). Only one channel per camera can be activated on the receiver. In the case of several cameras, you should choose 1 different channel for each camera.

d.Viewing the camera or the cameras To view one or several cameras (if you have installed additional cameras), use the key . Caution, in the case of several cameras, you should make sure that they are parameterized in view in the menu. To do so, press the key “M” of the receiver, and make sure that the channels of the registered cameras are set on “ON” Example: “CAM ON” To modify it, select the channel with the key T and modify the state with the keys Wand X. The cameras in “OFF” position will not be visible during manual or automatic scrolling. The number in the left upper corner of the screen indicates the selected camera.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

e. Setting the sound volume Press the key “ok” a menu appears:

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Raise or lower the sound volume with the keys W and X of the monitor.

f. Scan Time or QUAD function (to use only in the case of several cameras)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

*%

Press the button “M” of the receiver. On “SCAN TIME” with the keys W and X , select the scrolling time (5, 10, 15, 20 seconds) or Display if QUAD mode.

(Reminder: only the cameras set on “ON” viewing mode will be visible, see paragraph d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

The camera 1 in the left upper corner the screen The camera 2 in the right upper corner the screen The camera 3 in the left lower corner the screen The camera 4 in the right lower corner the screen

CH3

of of of of

Black screen for the cameras non-connected or not activated (OFF).

CH4

Note: in QUAD mode the keys “M”, QUAD mode by pressing S TW X .

and

are not activated. First you should exit

h. Zoom function Press the button of the remote control unit to zoom in the video of the selected camera. You have the possibility to move the zoomed video with the arrow buttons STWX of the remote control unit or the monitor. Press again the same button to return to the initial video.

i. Signal quality The reception quality is represented by bars at the left side of the antenna symbol on the left upper corner of the video. The higher the number of bars, the better signal quality. See table below. Level of signal

Flow

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

725~1062Kbps

3~5Fps

12~20Fps

Medium

543~725Kbps

2~4Fps

8~15Fps

Low

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Very good Good

Absent

Display

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

7. DISPLAY ON A PC

1

2

Do not use the RCA cable for this type of connection.

CAUTION

*%

You must have installed on your PC the software supplied in order to connect the receiver.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. USING THE KIT WITH A PC

a. Installing the software with CD-ROM supplied “GUARDING HOME EDITION” Insert the CD-ROM supplied in your CD drive to install the software “GUARDING RECORDER”. Start of installation “Autorun”

Check the box with the desired language, validate with »

Validate with »

Follow the instructions “ok”

Click “next” to continue Click “browse” to change folder

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

Registration of software licence : During the installation, register the name and the code indicated on the jacket of the supplied CD-ROM, respect imperatively lowercase and capital and the code syntax: xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Connecting the monitor

2

Connect the USB cable (supplied with the kit) to the relevant plug at the back of the monitor and to a USB port available on a PC. Once connected a message appears at the left lower corner of the monitor indicating that the material is ready to be used. Double click the icon which appeared on your desktop.

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Presentation of the software “ENREG PROTECTION”

Insert the program on the bar at the left lower corner - Reduce the program on the task bar x Close the program F

Extension menus

Indicator of the cameras

1

2

3

4

5

6

7

8

1. Indicator of camera connection and sound 2. Safety settings 3.Video capture 4. Taking a picture 5. List of events 6. Conﬁguration of the display 7. About? Software version – Cap – Licence registration 8. Zoom/Direction control panel

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

I - INDICATOR OF CAMERA CONNECTION AND SOUND

Indicates the quality of the camera signal and active sound

Indicates no camera connected and no active sound

II - SAFETY SETTINGS

a. Motion detection You can use your video surveillance system as an alarm system. A movement within the ﬁeld of the camera will trigger an alarm and will record according to the conﬁguration you parameterized.

Level of sensitivity Setting from 0 to 100 Setting the duration of the alarm

Setting alarm only or alarm and recording: Each detection creates a record into the folder parameterized by the user Setting backup Chapter a. Chapter b. Chapter c.

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programming recording events Parameterization on 24h

Segmentation by section of 2h Selection of the type of event Selection of the camera affected by the type of event Selection of the resolution Selection of the recorded format when detecting (video clip or picture) Click this icon to save the settings

: Enables recording a video on a speciﬁed time slot. The video is recorded directly into the folder selected by the user (see next chapter).

: A motion detection activates a ﬁlm recording or a series of pictures. A single video bit stream is recorded (1 camera at a time).

c. Programming recording directory Parameterization of the recording directory by clicking the yellow folder icon. Possibility to change your recording folder

Parameter of saving time of a ﬁle. Example: 7 days or less. If validated, the ﬁles are conserved. Click this icon to save the settings

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

III - VIDEO CAPTURE Selection of a recording directory Erasing the video previously recorded

1. Recording the video displayed on the screen. Then a red dot appears on the screen 2. Slowing down of the video in play mode up to 1/16 3. Play the recorded video 4. Acceleration of the video in play mode up to x10 5. Stop the video during the play mode

1

2

3

4

5

IV - TAKING PICTURES

1

2

3

4

5

6 1. Clicking the icon enables to take a picture of the image displayed on the screen – the pictures are recorded temporarily in the below rectangle 2. Records the pictures taken into a folder you selected 3. Erases the pictures from the most recent to the older ones 4. Records all the pictures indicated under the rectangle in a directory you selected 5. Erases all the pictures indicated under the rectangle 6. Print a selected highlighted picture in the rectangle

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LIST EVENTS 1

2

3

4

5

1. Sorts the takes by name of camera 2. Sorts the takes by date 3. Sorts the takes by mode (type of takes) picture or clip… 4. Deleting a take 5. Deleting all the different picture or video takes

indicates the date and the time of an alarm by detection and video recording in “avi” format. By selecting “highlighting” the video ﬁle a control panel appears:

- slowing down of the video in play mode up to 1/16 - play the recorded video - acceleration of the video in play mode up to x10 - stop the video during the play mode

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

indicates the date and the time of an alarm by detection and taking pictures.

For each function of events, the program creates and names a different recording folder.

Folder for alarm with programmed detection Folder for programmed video capture Video clip folder controlled by the user

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURATION OF THE DISPLAY

Click the icon Chapter a. Chapter b. Chapter c.

The following menu appears

a. Device : non used

b. Display Buffer duration: displays or hides the clock and date Name cam: displays or hides the name of the camera

Enables naming the cameras

Important: Click this icon to save

c. Languages

Selection of the language used for the software.

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

VII - ABOUT? SOFTWARE VERSION

Click the icon

1-Indicates the software version 2-Indicates the activation (licence registration) of the software 3-Checks the software updates by Internet (non used)

VIII - ZOOM / DIRECTION CONTROL PANEL

Normal display

*%

Active zoom mode (then the arrows become valid)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. MAINTENANCE The warranty is void if the parts are dismantled. Clean the outside only with a soft and dry cloth. Before cleaning, disconnect and switch off the video surveillance system. Caution: Do not use any acid or alcohol based or other similar cleaning product or solvent. You may damage the appliance and the vapours are explosive and dangerous for your health. Do not use any tool which can be voltage conductor (metallic brush, sharp tool…or other) for cleaning.

10. TROUBLESHOOTING With this video surveillance system, you have bought a high technology and ready to use product. All parts are supplied to use completely your kit. Nevertheless if you encounter problems or dysfunctions, you can remedy these defects by reading the following table: Defect

Cause

Solution

The receiver does not turn on

Power supply problem

Check the connection of the adaptor

No image and message “no signal”

• The camera is not powered • The camera is not paired • The signal is not received by the receiver

• Check the connection of the adaptor • Refer to Chapter 6. c. • Bring closer the camera and ﬁnd a more suitable location

Impossible to display the additional cameras

The cameras are not validated on the receiver

Refer to Chapter 6. d.

The remote control unit does not work

• If it is the 1st use, remove the transparent protection from the battery • Replace the battery

If necessary, our technical website is at your disposal www.cﬁ-extel.com

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

11. SAFETY INSTRUCTIONS The damages caused by the non-compliance to the manual lead to the expiration of the warranty. We will not assume any responsibility for the resulting damage! We will not assume any responsibility concerning any damage, to the goods or people, caused by improper handling or by non compliance with the safety instructions. This product has been manufactured in compliance with safety instructions. In order to keep this status and ensuring the best operation of the product, the user must respect the safety instructions and warnings contained in this manual. The user of this system is responsible for checking whether the video surveillance is compliant with the law in force in the country of use.

CAUTION

Informs the user about the presence of important instructions concerning the use and the maintenance (repair) in the documentation supplied with the appliance.

Informs the user about the presence of “hazardous voltages” non-isolated inside the housing of the product, being sufﬁciently high to represent a risk of electrocution for people.

This symbol indicates a risk of electric shock or a risk of short circuit - You should only use this product within a voltage range between: 100-240 Volts and 50-60 hertz. Never intend to use this product with a different voltage. - Make sure all electrical connections of the system are compliant with instructions of use. - In commercial establishments, make sure to respect the rules for preventing accidents with the electrical installations. - In schools, training institutions and workshops… the presence of a qualiﬁed personnel is necessary to control the operation of electronic appliances. -Respect the instructions of use of other appliances connected to the system. (video recorder, TV, PC for example) - Please contact an experienced person in case of doubt concerning the mode of operation or the safety of the appliances. - Never connect or disconnect the electrical appliances with wet hands. - When installing this product, check the power supply cables are not liable to be damaged. - Never replace the damaged electrical cables by yourself! In this case, remove them and contact an experienced person.

*%

CFI EXTEL WESV 82600 - 10/2011 - V1

12. FCC/CE WARNING

Note : This equipment has been tested and found compliant with the limits of a Class B appliance, according to the European standards in force. These limits are designed to supply a reasonable protection against the interference in a residential installation. This equipment, uses and can radiate radio frequency energy and if it is not installed and used according to the instructions, may interfere with radio communications. Nevertheless, there is no guarantee that interference will not occur in a particular installation. If this equipment does cause harmful interference to radio or television reception, which can be determined by turning the equipment off and on, the user is encouraged to try to correct the interference by one or more of the following measures: • Reorient or relocate the receiving antenna • Increase the distance between the equipment and receiver • Connect the equipment into an outlet on a circuit different from that to which the receiver is connected

Notification FCC/CE Some rules have to be respected: The appliances using radio waves must be compliant with rules and regulations. The power of the transmitter is limited. A receiver cannot respond to more than one signal at a time and thus can be interfered by radio signals close to their operation frequencies.

CFI EXTEL WESV 82600 - 10/2011 - V1

*%

INHOUD 1 VEILIGHEIDSINSTRUCTIES .............p.3

7 WEERGAVE OP EEN PC

2 SAMENSTELLING VAN DE KIT .......p.4

8 GEBRUIK VAN DE KIT MET EEN PC

3 TECHNISCHE EIGENSCHAPP ....... p.4

a. Technische gegevens b. Kastje met de ontvanger c. Camera (SVCM 82501) 4 INSTALLATIE VAN DE CAMERA.....p.6 a. Beschrijving van de camera b. Installatie van de camera c. Bevestiging van de houder van de camera d. Aansluiting van de camera e. Infrarood verlichting f. Extra camera’s g. Het koppelen van de camera of camera’s

................ p.14

.................................................................. p.15 a. Installatie van de software ‘GUARDING HOME EDITION vanaf de cd-rom b. Aansluiting van de monitor c. Presentatie van de software ‘Enreg. protection’

ONTVANGER... ..........................................p.8 a. Beschrijving van de ontvanger b. Installatie van de ontvanger. c. Verbinding van het kastje van de ontvanger met een TV of een monitor

I - INDICATOR VAN DE VERBINDING VAN DE CAMERA EN HET GELUID II - VEILIGHEIDSINSTELLINGEN a. Bewegingsdetectie: b. Programmering van de gebeurtenissen van de opname b. Programmering van een directory met opnames III - VIDEO-OPNAME IV - MAKEN VAN FOTO V - LIJST EVENEMENTEN VI - CONFIGURATIE WEERGAVE a. Apparaat.: niet gebruikt b.Weergave c.Taal VII - INFORMATIE? VERSIE VAN DE SOFTWARE VIII - INZOOMEN /PANEL VAN DE RICHTINGSBESTURING

6 FUNCTIE EN GEBRUIK VAN DE KIT

9 ONDERHOUD ................................. p.25

5 INSTALLATIE VAN DE

.................................................................. p.10 a. Ingebruikneming b. Verbinding van de camera’s c. De camera aan de ontvanger koppelen d. Weergave van de camera of de camera’s e. Instelling van het geluidsvolume f. Functie Scan Time of QUAD g. Instelling van het scherm h. Functie zoom i. Kwaliteit van het signaal

1/

10 REPARATIE ...................................... p.25 11 VEILIGHEIDSINSTRUCTIES .......... p.26 12WAARSCHUWING FCC/CE

CFI EXTEL WESV 82600 - 10/2011 - V1

.......... p.27

MINIMALE CONFIGURATIE

Een processor van minstens 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB aan RAM-geheugen aanbevolen 1 GB vrije ruimte op de harde schijf. Kleurenmonitor met een videokaart van minstens 16 bit Beeldscherm met een resolutie van 1024x768 en minstens 96 dpi Compatibele videokaart microsoft direct x9 of hoger CD-Romstation voor de installatie van de software Een vrije USB-poort (1.1 of meer) De software is uitsluitend compatibel met de kit.

1. VEILIGHEIDSINSTRUCTIES Belangrijk! • Lees de gebruiksaanwijzing zorgvuldig door, voordat u dit product installeert of gebruikt. • Als u dit product installeert voor derden, denk er dan aan om de handleiding of een kopie achter te laten voor de eindgebruiker. Waarschuwing: • De verschillende onderdelen mogen alleen worden gedemonteerd door een bevoegde technicus. Veiligheidsmaatregelen: • Voor een veilig beheer van dit systeem, is het noodzakelijk dat de installateurs, gebruikers en technici alle veiligheidsprocedures volgen die in deze handleiding zijn beschreven. • Er worden zonodig speciﬁeke waarschuwingen en aandachtssymbolen aangegeven op de onderdelen. De gebruiker van dit systeem is geheel zelf voor het bewakingssysteem verantwoordelijk en is verplicht om te controleren of de bewaking in overeenstemming is met de geldende wetgeving in het land waarin BELANGRIJK het wordt gebruikt. (In Frankrijk: informeer u bij de prefectuur van uw departement Buiten Frankrijk: Informeer bij de competente autoriteiten op het gebied van het gebruik van producten van videobewaking (Directie van burgerlijke vrijheden, Bureau van Algemene Reglementen ...) Hoewel ze digitaal zijn, zijn de camera's gevoelig voor interferentie van draadloze telefoons, magnetrons en andere draadloze apparatuur die werken op 2.4 GHz (WIFI bijvoorbeeld). Houd het systeem tijdens de installatie en het gebruik op minstens 3 meter afstand van dergelijke apparatuur. CFI EXTEL WESV 82600 - 10/2011 - V1

1/

2. SAMENSTELLING VAN DE KIT

• 1 Draadloze camera 2.4 GHz • 1 Kastje met de ontvanger 2.4 GHz • 1 Houder voor de ontvanger • 2 5VDC-adapters voor de camera en de ontvanger • 1 Zakje met schroeven • 1 RCA-Jack kabel voor Audio/Video-uitgang • 1 USB-kabel • 1 CD, software voor de videobewaking op een PC • 1 Gebruikershandleiding

3. TECHNISCHE EIGENSCHAPP a. Technische gegevens Speciﬁcatie RF Radiofrequentie 2,402-2,454 GHz Numerieke Modulatie GFSK: ‘Frequency Hopping Spread Spectrum’ Anti-interferentie Frequentie-uitvoer: 2Mbps Breedte van de band van de keten: 2MHz

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Kastje met de ontvanger Voeding: 5V DC. Verbruik: 300 mA. Kanalen: 4. Frequentie van de ontvangst: 2,402-2,454 GHz. Afmetingen: ‘85 x 82 x 25 (mm)’. Gewicht: 140 gram. Gebruikstemperatuur: -10°C tot + ongeveer 50° C. AV OUT: Aansluitingen audio/video: jack-plug 3,5 mm. PC OUT: USB-aansluiting

c. Camera (SVCM 82501) Voeding: 5V DC. Verbruik: 1000 mA. Kanalen: 4. Transmissie van de frequentie: 2,402-2,454 GHz. Gevoeligheid voor het licht: 1-8 lux* (* Zorg voor extra verlichting ’s nachts). Infraroodlicht: 24 Infrarode diodes. Gewicht (zonder houder): 240 g. Gebruikstemperatuur: van ongeveer -10°C tot 40° C. Afmetingen: 164 x 64 x 42 (mm). Resolutie: 640 x 480 pixels bij 25 beelden/s. Beeldhoek: 53°. digitale verbinding tussen de camera en de ontvanger (deze technologie begrenst de interferenties en de verstoringen in de verbinding). Bereik: ongeveer 150 m in de vrije ruimte.

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

4. INSTALLATIE VAN DE CAMERA

WAARSCHUWING

Verzeker u ervan dat geen enkel element het plaatsen van de schroeven in de muren hindert.

a. Beschrijving van de camera 1 11

10

2

3

4 7

3

8

9

12 13

14 6

1.Verstelbare antenne die op de achterkant van de camera geschroefd moet worden. 2. Bescherming van de camera’s (IP 44) 3. Lens van de camera. 4. Schroef om de positie van de camera vast te zetten. 5. Camerahouder. 6. Microfoon (in het lege deel van het kastje). 7. Stekker om de adapter mee aan te sluiten. 8. Cel om de IR-diodes in het donker te activeren. 9. Infrarode Diode (niet zichtbaar licht). 10. Rood lampje, geeft aan dat er spanning op de camera staat. 11. Groen lampje, geeft aan dat de camera op de monitor wordt aangegeven. 12. Bevestigingsschroef voor de houder. 13. Knop om de camera met de monitor te verbinden: ‘pairing key’ (verbindingsknop). 14. Adapter 5 VDC (gebogen stekker).

b. Installatie van de camera Kies een geschikte plaats voor de installatie van de camera. Voor zover dat mogelijk is, dient uw systeem op een stofvrije plek te worden geïnstalleerd, met geringe trillingen en een goede luchtcirculatie en uitgerust te zijn met een wandcontact voor de 5 VDC-adapter. Controleer tijdens het installeren van de camera dat de videobeelden goed op de monitor worden ontvangen, voordat u overgaat op de deﬁnitieve installatie. Laat bijvoorbeeld iemand de camera vasthouden op de te bewaken plaats.

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

Laat een andere persoon op verschillende plekken in het huis de monitor plaatsen, om de ontvangst van het videosignaal te controleren. Als u interferenties of andere problemen tegenkomt, raadpleeg dan het hoofdstuk ‘Onderhoud’. Assemblage van de verschillende onderdelen van de camera (A). U hebt de mogelijkheid om de houder van de camera (B) te verplaatsen als u de verstelbare steun voor het plafond (C) gebruikt.

A

B

C

c. Bevestiging van de camerahouder • Verzeker u er van dat de installatie door geen enkel element wordt gehinderd. • Zoek een geschikte plek om de houder te bevestigen. • Schroef het wandgedeelte vast met de meegeleverde schroeven (gebruik zonodig pluggen) • Schroef de camera op de houder. • Richt de camera in de gewenste richting en draai de schroef aan de zijkant vast.

d.Verbinding van de camera 1.Verbind het snoer van de 5VDC adapter met de ‘Voedingsingang’ van de camera. 2. Sluit de adapter aan op een stopcontact 230 VAC (het rode lampje gaat branden). CFI EXTEL WESV 82600 - 10/2011 - V1

1/

e. Infrarode belichting De infrarode dioden geven licht af dat niet met het blote oog waarneembaar is. De infrarode belichting wordt automatisch geactiveerd in het donker.

f. Extra camera’s U hebt de mogelijkheid om uw installatie aan te vullen met extra camera’s (op de ontvanger kunnen tot 4 camera’s worden aangesloten).

g. Het koppelen van de camera of camera’s De camera die bij de kit wordt geleverd is al gekoppeld, iedere extra camera moet tevens met de ontvanger worden ‘verbonden’. Als dat niet het geval is, raadpleeg dan hoofdstuk 6-c ‘De camera met de ontvanger verbinden’.

5. INSTALLATIE VAN DE ONTVANGER Installeer de ontvanger op ongeveer 1 m afstand van de grond (voor optimale ontvangstcondities). Kies voor de plaats van de ontvanger een plek die niet in de buurt is van muren van gewapend beton, spiegels, metalen rekken etc. Houd de ontvanger uit de buurt van alle apparaten die voor sterke elektrische interferenties zorgen. Om het even welke omgeving met sterke elektrische ladingen kan voor interferenties zorgen en het gebruik verstoren (in het bijzonder WIFI).

a. Beschrijving van de ontvanger 1

9

12 11 13

2 M

3

4 5 6

14

7

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1.Verstelbare antenne die op de achterkant van de ontvanger geschroefd moet worden. 2. Audio/Video-uitgang op de mini-jack 3. Ingang 5VDC-voeding. 4. Lampje dat aangeeft dat de camera aanstaat. • Als het lampje groen is, betekent dat er geen enkele camera is gekoppeld. • Als het lampje uit is, betekent dat er minstens 1 camera is gekoppeld 5. Het rode lampje knippert gedurende het aftellen bij de koppeling van een camera, dit gaat weer uit zodra de camera is gekoppeld. 6. Het groene lampje geeft aan dat er spanning op de ontvanger staat. 7. 5 VDC-adapter 8. Audio/Video kabel 9. Steun kastje met de ontvanger. 10. USB-aansluiting 11. USB-aansluiting 12. Besturingspad STWX knop ‘M’ waarmee het menu weergegeven kan worden (via de TV). 13. Met de knop kan op de video worden ingezoomd. 14. Met de knop kunnen camera’s worden gekoppeld en gekozen.

b. Installatie van de ontvanger

Laat de houder in de juiste rail glijden.

WAARSCHUWING

Plaats de ontvanger alleen op harde en stabiele oppervlakken.

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

c. Verbinding van het kastje van de ontvanger met een TV of een monitor

2 1 Audio

Video

De kabel USB niet voor dit soorten aansluitingen gebruiken

In het geval dat u beeld van slechte kwaliteit ontvangt, dient u te controleren dat het formaat van het gekozen videosignaal compatibel is met uw scherm. 1. Schakel de stroom van de apparaten uit 2.Verbind de twee apparaten met behulp van de meegeleverde RCA/Jack-kabel. 3. Sluit de mini jack-kabel aan op de achterkant van de ontvanger op de AV-uitgang en met de gele (video) en witte (audio) RCA jackplugs. (zie de bovenstaande afbeelding) 4.Verbind het snoer van de 5VDC-adapter met de ‘Voedingsplug’ van de ontvanger. 5. Sluit de adapter aan op een stopcontact 230 VAC: het lampje wordt groen. 6. Schakel de monitor aan.

6. FUNCTIE EN GEBRUIK VAN DE KIT a. Ingebruikneming Druk op de knop stoppen).

‘Aan/Uit’ (gebruik dezelfde knop om het kastje van de ontvanger te

b. Aansluiting van de camera’s 1-Verbind het snoer van de 5VDC-adapter met de ‘Voedingsingang’ van de camera. 2-Sluit de adapter aan op een stopcontact.

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Verbind de camera met de ontvanger Bij het eerste gebruik is de camera in de kit al gekoppeld. Als dat niet het geval is, of als u een andere camera toe wilt voegen, dan handelt u op de volgende wijze: Druk op de toets ‘M’ van het kastje van de ontvanger en open met de toets T het menu ‘PAIR CAM’ (camera koppelen). Kies een vrij kanaal tussen 1, 2, 3 en 4 met de knoppen W en X . Druk op de knop om met de opname te starten. U hebt nu 60 secondes de tijd om de camera te koppelen. Open de deksel die achter op de camera zit en druk op de knop ‘Pairing key’ (toets koppelen) met behulp van een scherp voorwerp (bijvoorbeeld een paperclip). Er kan maar één kanaal per camera op de ontvanger worden geactiveerd. Indien u meerdere camera’s gebruikt, dient u een ander kanaal voor elke camera te kiezen.

d. Weergave van de camera of de camera’s Om één of meer camera’s (als u extra camera’ s hebt geplaatst) weer te geven, dient u de toets te gebruiken. Let op, als er meerdere camera’s worden gebruikt, moet u controleren dat ze in het menu op ‘weergave’ zijn ingesteld. Daarvoor dient u op de toets ‘M’ van de ontvanger te drukken en na te gaan dat de kanalen van de geregistreerde camera’ s op de stand ‘ON’ (aan) staan. Bijvoorbeeld: ‘CAM ON’ Om dit te wijzigen kiest u het kanaal met de toets T en u wijzigt de status met de toetsen W en X . De camera’s in de posities ‘OFF (uit) zijn niet zichtbaar als u er handmatig of automatische langsschuift. Het cijfer linksboven in het scherm geeft de geselecteerde camera aan.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

e. Instelling van het geluidsvolume Druk op de knop ‘OK’ waarna een menu opengaat:

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Verhoog of verlaag het geluidsvolume met de toetsen W en X van de monitor.

f. De functie Scan Time of QUAD (alleen gebruiken als er meerdere camera’s geïnstalleerd zijn)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

1/

Druk op de toets ‘M’ van de ontvanger. Op ‘SCAN TIME’ kunt u met de toetsen W en X de tijdsduur van de weergave kiezen (5,10, 15, 20 secondes) of kiezen voor de weergave in de modus QUAD.

(Opmerking : alleen de camera’s in de weergavemodus ‘ON’ (aan) zijn zichtbaar, zie paragraaf d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

De camera 1 linksboven in het scherm. De camera 2 rechtsboven in het scherm. De camera 3 linksonder in het scherm. De camera 4 rechtsonder in het scherm. Zwart scherm voor de camera’s die niet zijn aangesloten of niet zijn geactiveerd (OFF). CH3

CH4

Let op: in de modus QUAD zijn de knoppen ‘M’, en niet langer geactiveerd. Nu moet de modus QUAD eerst afsluiten door op S TW X te drukken.

h. Functie inzoomen Druk op de toets van de afstandsbediening om met de gekozen videocamera in te zoomen. U hebt de mogelijkheid om het ingezoomde videobeeld te bewegen met behulp van de pijlen S TW X van de afstandsbediening of van de monitor. Druk opnieuw op dezelfde knop om terug te gaan naar de oorspronkelijke video.

i. Kwaliteit van het signaal De kwaliteit van de ontvangst wordt weergegeven door de balken aan de linkerkant van het symbool van de antenne, links van de video. Hoe meer balken er worden weergegeven, hoe beter de kwaliteit van het signaal is. Zie de onderstaande tabel. Niveau van het signaal Zeer goed

Weergave

Snelheid

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

Goed

725~1062Kbps

3~5Fps

12~20Fps

Matig

543~725Kbps

2~4Fps

8~15Fps

Laag

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Afwezig

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

7. WEERGAVE OP EEN PC

1

2

De kabel RCA niet voor dit soorten aansluitingen gebruiken.

WAARSCHUWING

1/

Op uw PC dient u verplicht de meegeleverde software installeren alvorens de ontvanger aan te sluiten.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. GEBRUIK VAN DE KIT MET EEN PC

a. Installatie van de software met de meegeleverde cd-rom ‘GUARDING HOME EDITION’ Plaats de meegeleverde cd-rom in uw CD-speler om de software ‘GUARDING RECORDER’ te installeren. Start de installatie ‘Autorun’

Kruis de taal van uw keuze aan, bevestig met »

Bevestig met »

Volg de instructies « ok »

Klik op «volgende» om verder te gaan Klik op «bladeren» om van dossier te veranderen

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

Registreren van de softwarelicentie: Gedurende de installatie kunt u de naam en de code, die op het hoesje van de cd-rom staan, registreren. U dient de kleine letters en de hoofdletters en de syntaxis van de code te respecteren: xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Aansluiting van de monitor

2

Sluit de kabel USB (met de kit geleverd ) aan op de USB-poort aan de achterkant van de monitor en op een vrije USB-poort van de PC. Nadat de verbinding is gemaakt deelt een bericht linkeronder op de monitor mee dat het materiaal gebruiksklaar is. Dubbelklik op de icoon die op het bureaublad van uw PC staat.

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Presentatie van de software ‘ENREG PROTECTION’

Plaats het programma op de balk linksonder - Verklein het programma op de taakbalk x Sluit het programma F

Uitbreiding menu’s

Indicator van camera’s

1

2

3

4

5

6

7

8

1. Indicator van de verbinding van de camera en het geluid 2.Veiligheidsinstellingen 3.Video-opname 4. Maken van foto 5. Lijst met evenementen 6. Conﬁguratie weergave 7. Informatie? Versie van de software – Update – Registratie licentie 8. Inzoomen /Paneel van de richtingsbesturing

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

I - INDICATOR VAN DE VERBINDING VAN DE CAMERA EN HET GELUID

Geeft de kwaliteit van het camerasignaal en actieve geluid aan Geeft aan dat de camera niet is aangesloten en dat het geluid niet actief is

II - VEILIGHEIDSINSTELLINGEN

a. Bewegingsdetectie U kunt uw systeem van videobewaking ook als alarmsysteem gebruiken. Een beweging in het veld van de camera zal een alarm af doen gaan en een video-opname maken, afhankelijk van de ingestelde conﬁguratie.

Niveau van gevoeligheid Instelling van 0 tot 100 Instelling van de duur van het alarm Instelling van alleen het alarm of ook met video-opname: Bij elke bewegingsdetectie wordt er een opname gemaakt en deze wordt opgeslagen in de map die door de gebruiker daarvoor is aangewezen Opslaan van instellingen Hoofdstuk a. Hoofdstuk b. Hoofdstuk c.

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programmering van de gebeurtenissen van de opname Instelling over 24h

Segmentatie per duur van 2 uur Keuze van type gebeurtenis Keuze van de camera die door het type gebeurtenis wordt gebruikt Keuze van de resolutie Keuze van het opgenomen formaat bij een bewegingsdetectie (video-opname of foto) Op deze icoon klikken om de instellingen op te slaan

: maakt het mogelijk om een video op een aangegeven tijdstip op te nemen. De video wordt direct in de map opgeslagen die door de gebruiker is gekozen (zie volgend hoofdstuk). : een bewegingsdetectie activeert de video-opname of het nemen van een serie foto’s. Er wordt één enkele videoﬂux opgenomen (1 camera per keer).

c. Programmering van een directory met opnames Instelling van een directory met opnames door op de gele icoon van de map te klikken. Mogelijkheid om van map met opnames te veranderen. Instellingen van het tijdstip van het opslaan van het bestand. Bijvoorbeeld: minstens zeven dagen. Indien bevestigd worden de bestanden bewaard. Op deze icoon klikken om de instellingen op te slaan

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

III - VIDEO-OPNAME Keuze van een directory met opnames Uitwissen van de video die eerder werd opgenomen 1. Opname van de video die op het scherm wordt weergegeven. Er verschijnt dan een rood punt op het scherm 2. Vertraging van de video in de modus afspelen tot 1/16 3. Afspelen van de video die is opgenomen 4. Versnelling van de video in de modus afspelen tot x10 5. Stoppen van de video in de modus afspelen

1

2

3

4

5

IV - MAKEN VAN FOTO

1

2

3

4

5

6 1. Door op de icoon te klikken, kan een foto van het beeldscherm worden gemaakt - de foto’s worden tijdelijk in de rechthoek onderaan opgeslagen 2. Slaat de gemaakte foto’s op in een map van uw keuze 3. Om de oudste of de meest recente foto’s te wissen 4. Slaat alle foto’s op die onder de rechthoek in de map van uw keuze worden aangegeven 5. Wist alle foto’s die onder de rechthoek worden aangegeven 6. Drukt een foto af die lichter in de rechthoek wordt aangegeven

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LIJST EVENEMENTEN 1

2

3

4

5

1. Sorteert de opnames per naam van de camera 2. Sorteert de opnames per naam van de camera 3. Sorteert de opnames per modus (type opname) foto of video… 4. Wissen van een opname 5. Wissen van alle opgenomen foto’s en video’s

Geeft de datum en het uur van een alarm door bewegingsdetectie aan en maakt een video-opname in het formaat ‘avi’. Door het helder weergegeven videobestand te kiezen, verschijnt er een controlepaneel: -vertraging van de video in de modus afspelen tot 1/16 - Afspelen van de video die is opgenomen - Versnelling van de video in de modus afspelen tot x10 - Stoppen van de video in de modus afspelen

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

Geeft de datum en het uur van een bewegingsdetectie en een alarm aan en maakt een foto.

Voor elke functie van de gebeurtenissen is het dossier met opnames verschillend. Het programma slaat in de gekozen map afhankelijk van de functie alle groepen opnames anders op.

Map voor alarm met geprogrammeerde detectie Map met geprogrammeerde video-opname Map met video-opnames die door de gebruiker worden gecontroleerd

1/

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - CONFIGURATIE WEERGAVE

Klik op de icoon Hoofdstuk a. Hoofdstuk b. Hoofdstuk c.

Het volgende menu wordt weergegeven

a. Apparaat : Niet gebruikt

b. Weergave Duur buffer: weergeven of verbergen van de tijd en de datum Naam camera: weergeven of verbergen van de naam van de camera

Maakt het mogelijk om de camera’s te benoemen Belangrijk: Klik op deze icoon om op te slaan

c.Taal

Keuze van de taal die door het programma wordt gebruikt.

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

VII - INFORMATIE? VERSIE VAN DE SOFTWARE

Klik op de icoon

1-Geeft de versie van de software weer 2-Geeft de activatie (registratie van de licentie) van de software weer 3-Veriﬁeert de updates van de software per Internet (niet gebruikt)

VIII - INZOOMEN /PANEL VAN DE RICHTINGSBESTURING

Normale weergave

1/

Modus inzoomen actief (de pijlen worden dan actief)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. ONDERHOUD

De garantie vervalt indien u onderdelen demonteert. Reinig alleen buitenkant met een droge en zachte doek. Trek voordat u het videobewakingssysteem reinigt de stekker uit of zet het apparaat uit. OPGELET: Gebruik geen producten die stoffen als carboxyl, alcohol of eensgelijks bevatten. Behalve het risico dat het uw apparaat beschadigt, zijn de dampen gevaarlijk voor uw gezondheid en zijn ze explosief. Gebruik bij het schoonmaken geen hulpmiddelen die de stroom geleiden (metalen borstels, puntige voorwerpen... of anders).

10. REPARATIE

U hebt een videobewakingssysteem gekocht van de meest recente technologie die klaar is voor gebruik. Alle onderdelen zijn meegeleverd om de kit helemaal te kunnen gebruiken. Indien u desondanks problemen of gebreken tegenkomt, kunt u deze oplossen met behulp van de volgende tabel: Storingen

Oorzaak

Oplossing

De ontvanger gaat niet aan

Probleem met de voeding

Veriﬁeer de aansluiting van de adaptor

Geen beeld en indicatie ‘geen signaal’

• Er staat geen stroom op de camera • De camera is niet gekoppeld • Het signaal wordt niet door de ontvanger ontvangen

• Veriﬁeer de aansluiting van de adaptor • Raadpleeg het hoofdstuk 6. c. • De camera dichterbij plaatsen en een betere plaats vinden

Het is onmogelijk om extra camera’s weer te geven

De camera’s zijn niet door de ontvanger bevestigd

Raadpleeg hoofdstuk 6. d.

De afstandsbediening functioneert niet

• Als dit het eerste gebruik is, dient u het beschermende lipje van de batterij te verwijderen • Vervang de batterij

Indien nodig staat onze technische dienst tot uw beschikking www.cﬁ-extel.com CFI EXTEL WESV 82600 - 10/2011 - V1

1/

11. VEILIGHEIDSINSTRUCTIES Schade die wordt veroorzaakt door het niet respecteren van de handleiding, leidt tot het vervallen van de garantie.Wij aanvaarden geen enkele verantwoordelijkheid voor schade die hier het gevolg van is! We aanvaarden geen enkele verantwoordelijkheid betreffende enige schade aan goederen of personen die is veroorzaakt door een verkeerd gebruik of door het niet respecteren van de veiligheidsinstructies. Dit product is vervaardigd met volledige inachtneming van de veiligheidsinstructies. Om deze veiligheid te behouden en om het optimale gebruik van dit product te garanderen, dient de gebruiker de veiligheidsinstructies en de waarschuwingen in deze handleiding in acht te nemen. De gebruiker van dit apparaat is er voor verantwoordelijk en is verplicht te controleren of de videobewaking in overeenstemming is met de geldende wetgeving in het land waarin het wordt gebruikt. Waarschuwt de gebruiker over de aanwezigheid van be-

WAARSCHUWING langrijke instructies betreffende het gebruik en het onderhoud (de reparatie) in de documentatie bij het apparaat. Waarschuwt de gebruiker over de aanwezigheid van nietgeïsoleerde ‘gevaarlijke spanningen’ binnenin de kast van het product die van voldoende omvang zijn om een risico op elektrocutie voor personen te betekenen. Dit symbool geeft een risico op elektrische schokken of kortsluiting aan. - U dient dit product alleen te gebruiken bij een spanning tussen 100-240 volt en 50-60 hertz. - Probeer dit apparaat nooit met een andere spanning te gebruiken. - Let erop dat alle elektrische aansluitingen van het systeem conform de gebruiksinstructies zijn. - Verzeker u er in bedrijven van dat u de regels voor het voorkomen van ongelukken inzake elektrische installaties in acht neemt. - Op scholen, opleidingen, werkplaatsen... is de aanwezigheid van bevoegd personeel noodzakelijk voor het controleren van de werking van elektrische apparaten. - Houd de gebruiksinstructies van andere apparaten die zijn verbonden met het systeem in acht. (videorecorder, TV, PC bijvoorbeeld) - Neem contact op met een deskundig persoon in het geval dat u twijfelt over de werking of de veiligheid van de apparaten. - U mag nooit met natte handen elektrische apparaten aansluiten of de stekkers uit stopcontacten trekken. - Controleer tijdens de installatie van dit product goed of de voedingskabels geen risico lopen beschadigd te raken. - Vervang nooit zelf beschadigde elektrische kabels! Verwijder ze in dat geval en doe beroep op een deskundig persoon. 1/

CFI EXTEL WESV 82600 - 10/2011 - V1

12. WAARSCHUWING FCC/CE Opmerking: deze uitrusting is getest en het is bewezen dat het conform de beperkingen van een toestel van Klasse B is, in overeenstemming met de geldende Europese normen. Deze beperkingen zijn ontwikkeld om een redelijke bescherming te bieden tegen interferenties in een installatie in een woning. Deze uitrusting gebruikt radiofrequentieenergie en kan deze uitzenden. En indien hij niet conform de instructies is geïnstalleerd en wordt gebruikt, kan hij interferenties aan radiocommunicaties veroorzaken. Er is echter geen enkele garantie dat de interferenties zich niet voordoen bij een bepaalde, specifieke installatie. Indien deze uitrusting interferenties veroorzaakt aan de radio- of televisieontvangst, wat kan worden vastgesteld door de uitrusting aan of uit te zetten, wordt de gebruiker aangeraden om te proberen de interferenties te corrigeren door ten minste één van de volgende maatregelen aan te nemen: • Heroriënteer of verplaats de ontvangende antenne • Vergroot de afstand tussen de uitrusting en de ontvanger • Sluit de uitrusting aan op een contact van een ander circuit dan dat waarop de ontvanger is aangesloten.

FCC/EG bekendmaking Er dienen enkele regels in acht te worden genomen: apparaten die gebruik maken van radiogolven zijn noodzakelijkerwijs in overeenstemming met de regels en reglementen. In die hoedanigheid is het vermogen van de zender beperkt. Een ontvanger kan niet beantwoorden aan meer dan één signaal tegelijkertijd en kan dus worden verstoord door radiosignalen in de buurt van zijn werkingsfrequenties.

CFI EXTEL WESV 82600 - 10/2011 - V1

1/

INHALTSVERZEICHNIS

1 SICHERHEITSEMPFEHLUNGEN ....p.3

7 ANZEIGE AUF PC

2 BAUSATZZUSAMMENSETZUNG

8 BETRIEB UND VERWENDUNG EINES

.....................................................................p.4 3 TECHNISCHE DATEN .......................p.4 a. Technische Besonderheiten b. Empfangsgehäuse c. Kamera (SVCM 82501) 4 INSTALLATION DER KAMERA

......p.6

a. Kamerabeschreibung b. Kamerainstallation c. Befestigung des Kameraträgers d. Kameraanschluss e. Infrarotbeleuchtung f. Zusatzkameras g. Anschluss der Kamera(s) 5 INSTALLATION DES EMPFÄNGERS

.....................................................................p.8 a. Beschreibung des Empfängers b. Installation des Empfängers c. Anschluss des Empfängergehäuses mit einem TV oder Monitor 6 BETRIEB UND VERWENDUNG EINES

BAUSATZES ............................................ p.10 a. Inbetriebnahme b. Kameraanschluss c. Die Kamera mit dem Empfänger verbinden d. Anzeige der Kamera oder Kameras e. Lautenstärkeneinstellung f. Funktion Scan Time oder QUAD g. Bildschirmeinstellung h. Zoom-Funktion i. Signalqualität

'

............................. p.14

BAUSATZES ........................................... p.15 a. Installation der mitgelieferten Software mit CD-Rom «GUARDING HOME EDITION» b. Anschluss des Monitors c. Präsentation der Software «Enreg. protection» I - INDIKATOR DES KAMERA- UND TONANSCHLUSSES II - SICHERHEITSEINSTELLUNGEN a. Bewegungsmelder: b. Programmierung der eingespeicherten Vorfälle c. Programmierung des Speicherverzeichnisses III - VIDEOAUFNAHME IV -FOTOAUFNAHME V - LISTE DER VORFÄLLE VI - KONFIGURATION DER ANZEIGE a. Gerät: nicht verwendet b. Anzeige c. Sprachen VII - ÜBRIGENS? SOFTWAREVERSION VIII - ZOOM / DIREKTIONSKONTROLLPANEL 9 WARTUNG ...................................... p.25 10 PANNENHILFE ................................ p.25 11 SICHERHEITSRATSCHLÄGE ........ p.26 12 FCC/CE WARNUNG

CFI EXTEL WESV 82600 - 10/2011 - V1

........................ p.27

MINDESTKONFIGURATION

Prozessor von mindestens 1 GHz Windows XP SP 1 – SP 2 / Windows Vista / Windows 7 1 GB RAM Speicher empfehlenswert 1 GB freier Platz auf der Festplatte Farbmonitor mit Videokarte mindestens 16 Bits Monitorauﬂösung 1024x768 mind. 96 dpi Graﬁkkarte kompatibel mit Microsoft Direct X9 oder darüber liegend CD-ROM-Spieler für die Installation der Software Ein freier USB-Port (1.1 oder mehr) Software nur mit diesem Bausatz kompatibel.

1. SICHERHEITSEMPFHLUNGEN Wichtig! • Bitte lesen sie dieses Handbuch sorgfältig durch bevor sie das Produkt installieren oder verwenden. • Wenn sie dieses Produkt für Dritte installieren denken sie bitte daran, das Handbuch oder eine Kopie für den Endverbraucher vor Ort zu lassen. Warnung: • Unterschiedliche Elemente dürfen nur von einem zugelassenen Techniker ausgebaut werden. Sicherheitsmaßnahmen: • Für einen Betrieb in aller Sicherheit dieses Systems ist es wichtig, dass Verwender und Techniker die in diesem Handbuch beschriebenen Sicherheitsverfahren befolgen. • Die speziﬁschen Warnungen und Warnsymbole sind falls notwendig auf den Elementen angegeben.

WICHTIG

DerVerwender dieses Produkts ist verantwortlich dafür zu überprüfen, ob die Verwendung dieses Geräts mit den gültigen Gesetzen für Videoüberwachungen im Verwendungsland übereinstimmen. (In Frankreich : Sich bei der Präfektur ihres Departements informieren Außerhalb Frankreichs : Sich bei den zuständigen Behörden für die Verwendung von Videoüberwachungsprodukten informieren (Direktion für staatsbürgerliche Grundrechte, Büro für allgemeine Vorschriften...)

Auch wenn es sich um digitale Kameras handelt, können diese auf Interferenzen von kabellosen Telefonen, Mikrowellen und anderen kabellosen Geräten von 2,4 GHz reagieren (z.B. WiFi). Halten während der Installation des Systems einen Abstand von mehr als 3 m von Vorrichtungen ein. CFI EXTEL WESV 82600 - 10/2011 - V1

'

2. SICHERHEITSEMPFHLUNGEN

• 1 kabellose Kamera 2.4 GHz • 1 Empfangsgehäuse 2.4 GHz • 1 Träger für den Empfänger • 2 5 VDC Adapter für die Kamera und den Empfänger • 1 Tüte Schrauben • 1 RCA Stecker für Audio/Video Ausgang • 1 USB Kabel • 1 CD,Videoüberwachungssoftware für PC • 1 Handbuch

3. TECHNISCHE DATEN

a. Technische Besonderheiten RF Speziﬁzierung Radio Frequenz 2,402-2,454 GHz Digitale Modulation GFSK: Frequency Hopping Spread Spectrum Anti-Interferenz Frenquenzdurchlauf: 2Mbps Bandbreite der Kette: 2MHz

'

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Empfangsgehäuse Stromversorgung: 5V DC. Verbrauch: 300 mA. Kanäle: 4. Empfangsfrequenz: 2,402-2,454 GHz. Maße: « 85 x 82 x 25 (mm) ». Gewicht: 140 Gramm Betriebstemperatur: etwa -10°C bis + 50°C. AV OUT : Audio/Video Anschlussstecker: Stecker 3,5 mm. PC OUT : USB Anschluss

c. Kamera (SVCM 82501) Stromversorgung: 5V DC. Verbrauch: 1.000 mA. Kanäle: 4. Frenquenzübermittlung: 2,402-2,454 GHz. Lichtsensibilität: 1-8 Lux * (eine Zusatzbeleuchtung für die Nacht vorsehen). Infrarotbeleuchtung: 24 Infrarotdioden. Gewicht (ohne Träger): 240 g. Betriebstemperatur: etwa -10°C bis + 40°C. Maße: 164 x 64 x 42 (mm). Auﬂösung: 640 x 480 Pixel bei 25 Bildern/S. Blickwinkel: 53°. Digitale Verbindung zwischen der Kamera und dem Empfänger (diese Technologie schränkt die Interferenzen und die Störungen in der Verbindung ein). Reichweite: etwa 150 m auf freiem Feld.

CFI EXTEL WESV 82600 - 10/2011 - V1

'

4. INSTALLATION DER KAMERA

ACHTUNG

Sich versichern, dass kein Element das Einschrauben der Schrauben in der Wand hindert.

a. Beschreibung der Kamera 1 11

10

2

3

4 7

3

8

9

12 13

14 6

1. Antenne einstellbar, wird auf der Kamerarückseite eingeschraubt 2. Kameraschutz (IP 44). 3. Kameraobjektiv 4. Schraube, um die Kameraposition zu befestigen 5. Kameraträger 6. Mikrofon (im leeren Teil des Gehäuses) 7. Stecker, um den Adapter anzuschließen. 8. Zelle, um die IR Ioden im Dunkeln zu aktieren 9. Infrarotdiode (nicht sichtbare Beleuchtung). 10. Rote Kontrollleuchte, die die Stromversorgung der Kamera bestätigt. 11. Grüne Kontrollleuchte, die signaliert, dass die Kamera auf dem Monitor angezeigt wird. 12. Befestigungsschraube für den Bogen. 13. Taste, um die Kamera mit dem Monitor zu verbinden: «Pairing Key». 14. 5 VDC Adapter (Winkelstecker).

b. Installation der Kamera Wählen sie einen geeigneten Ort für die Kamera aus. Soweit möglich, sollte ihr System an einem staubfreien Ort mit schwachen Vibrationen und einer guten Belüftung installiert werden, außerdem sollte eine Wandsteckdose für den 5 VDC Adapter vorhanden sein. Bei der Installation der Kamera überprüfen sie den guten Empfang der Bilder auf dem Monitor vor der endgültigen Installation. Lassen sie z.B. die Kamera in dem zu überwachenden Bereich von jemandem halten. Lassen sie durch eine dritte Person den Monitor an unterschiedlichen Orten im Haus halten, um einen korrekten Empfang zu erhalten. '

CFI EXTEL WESV 82600 - 10/2011 - V1

Wenn sie auf Interferenzen oder andere Probleme stoßen sollten, schauen sie bitte im Kapitel «Wartung» nach. Zusammenbau der unterschiedlichen Kamerateile (A), sie haben die Möglichkeit, den Befestigungsbogen der Kamera (B) zu verstellen, wenn sie den einstellbaren Träger an der Decke befestigen müssen (C).

A

B

C

c. Befestigung des Kameraträgers • Versichern sie sich, dass kein Element die Installation behindert. • Suchen sie sich einen geeigneten Platz, um den Träger zu befestigen. • Schrauben sie das Wandteil mit den mitgelieferten Schrauben an (Verwenden sie Dübel falls notwendig). • Schrauben sie die Kamera auf den Träger. • Drehen sie die Kamera in die gewünschte Richtung und ziehen sie die seitliche Befestigungsschraube an.

d. Kameraanschluss 1. Das Kabel des 5 VDC Adapters mit dem Stecker «Stromversorgung» der Kamera anschließen. 2. Den Adapter an eine 230 VAC Steckdose anschließen (die rote Kontrollleuchte erleuchtet). CFI EXTEL WESV 82600 - 10/2011 - V1

'

e. Infrarotbeleuchtung Das von den Infrarotdioden produzierte Licht ist für das bloße Auge nicht sichtbar. Die Infrarotbeleuchtung aktiviert sich automatisch in der Dunkelheit.

f. Zusatzkameras Sie haben die Möglichkeit ihre Installation mit Zusatzkameras zu vervollständigen (der Empfänger akzeptiert bis zu 4 Kameras).

g. Anschluss der Kamera(s) Die mit dem Bausatz gelieferte Kamera ist schon angeschlossen, jede weitere Kamera muss auch mit dem Empfänger «verbunden» werden. Wenn dies nicht der Fall ist, sehen sie bitte im Kapitel 6-c «Eine Kamera mit dem Empfänger verbinden» nach.

5. INSTALLATION DES EMPFÄNGERS Bauen Sie den Empfänger etwa 1 m über dem Boden ein (für optimale Empfangsbedingungen). Für die Installation des Empfängers, wählen sie einen Platz aus, der sich nicht in der Nähe von Stahlbetonwänden, Spiegeln, Metallregalen usw. beﬁndet. Lassen sie den Empfänger nicht in der Nähe von Geräten, die starke elektrische Interferenzen kreieren. Eine starke elektrische Umgebung kann Interferenzen hervorrufen und die Verwendung stören (im Besonderen WIFI).

a. Beschreibung des Empfängers

1

9

12 11 13

2 M

3

4 5 6

14

7

'

CFI EXTEL WESV 82600 - 10/2011 - V1

8

10

1. Einstellbare Antenne, auf der Empfängerrückseite einzuschrauben. 2. Audio/Video Ausgang auf Mini-Jack. 3. Eingang Stromversorgung 5VDC. 4. Kontrollleuchte für Kameraaktivität • wenn sie grün leuchtet, ist keine Kamera verbunden. • wenn sie nicht leuchtet, ist mindestens eine Kamera verbunden. 5. Kontrollleuchte blinkt rot während des Anschlussvorgangs einer Kamera und erlöscht wenn die Kamera eingespeichert ist. 6. Die grüne Kontrollleuchte bestätigt die Stromversorgung des Empfängers. 7. Adapter 5 VDC. 8. Audio/Video Kabel. 9. Träger Empfängergehäuse. 10. USB Kabel. 11. USB Anschluss. 12. Direktioneller Block STWX Taste «M» mit der das Menü angezeigt werden kann (über TV). 13. Taste ermöglicht, ein Video zu zoomen. 14. Taste ermöglicht die Kameras zu verbinden und auszuwählen.

b. Installation des Empfängers

Den Träger in der dafür vorgesehen Schiene durchschieben.

ACHTUNG

Den Empfänger nur auf harte und stabile Oberﬂächen abstellen.

CFI EXTEL WESV 82600 - 10/2011 - V1

'

c. Anschluss des Empfängergehäuses mit einem TV oder Monitor

2 1 Audio

Video

Für diese Art von Anschluss kein USB Kabel verwenden.

Bei einem schlechten Bild, überprüfen sie ob das gewählte Format des Videosignals mit ihrem Bildschirm kompatibel ist. 1. Die Geräte ohne Stromanschluss 2. Zwei Geräte mit Hilfe des mitgelieferten RCA/Jack Kabels verbinden 3. Das Mini-Jack Kabel auf der Empfängerrückseite in den AV out Ausgang sowie die RCA Stecker gelb (Video) und weiß (Audio) einstecken. (siehen obige Abbildung) 4. Verbinden sie das Kabel des 5VDC Adapters in den Stecker «Stromversorgung» des Empfängers. 5. Stecken sie den Adapter in eine 230 VAC Steckdose: die Kontrollleuchte leuchtet in grün. 6. Den Monitor mit dem Strom verbinden

6. BETRIEB UND VERWENDUNG EINES BAUSATZES a. Inbetriebnahme Auf die Taste auszustellen).

Ein Aus drücken (verwenden sie diese Taste, um das Empfangsgehäuse

b. Kameraanschluss 1. Verbinden sie das Kabel des 5VDC Adapters in den Stecker «Stromversorgung» der Kamera. 2. Stecken sie den Adapter in eine Steckdose.

'

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Die Kamera mit dem Empfänger verbinden Bei der ersten Inbetriebnahme der Kamera aus dem Bausatz, ist diese schon angeschlossen. Sollte dies nicht so sein oder um eine andere Kamera hinzuzufügen, wie folgt vorgehen: Auf die Taste «M» des Empfängergehäuses drücken und in das Menü «PAIR CAM» mit der Taste T gehen. Einen freien Kanal zwischen 1, 2, 3 und 4 mit den Tasten W und X auswählen . Auf die Taste drücken, um eine Aufnahme zu starten. Sie haben 60 Sekunden, um die Kamera anzuschließen. Die Abdeckung auf der Kamerarückseite hochheben und auf den Knopf «Pairing Key» mit Hilfe eines spitzen Gegenstands (z.B. eine Büroklammer) drücken. Nur ein einziger Kanal pro Kamera kann auf dem Empfänger aktiviert werden. Bei mehreren Kameras müssen sie 1 Kanal für jede Kamera auswählen.

d. Anzeige der Kamera oder Kameras Um eine oder mehrer Kameras anzuzeigen (wenn sie Zusatzkameras installiert haben), die Taste verwenden. Achtung bei mehreren Kameras müssen sie sich versichern, dass sie für eine Anzeige im Menü parametriert sind. Dafür auf die Taste «M» des Empfängers drücken und sich versichern, dass die für die Kameras eingespeicherten Kanäle auf «ON» stehen. Beispiel: « CAM ON » Für eine Änderung den Kanal mit der Taste T auswählen und den Zustand mit den Tasten W und X ändern. Die Kameras in der Position «OFF» sind bei dem manuellen oder automatischen Bilddurchlauf nicht sichbar. Die Zahl oben links auf dem Bildschirm zeigt die gewählte Kamera an.

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

CFI EXTEL WESV 82600 - 10/2011 - V1

'

e. Lautenstärkeneinstellung Auf die Taste «ok» erscheint ein Menü:

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Die Lautstärke mit den Tasten W und X auf dem Monitor erhöhen oder senken.

f. Funktion Scan Time oder QUAD (nur verwenden, wenn mehrere Kameras angeschlossen sind)

Audio Vol 10 Scan Time OFF Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1234 Reset

Audio Vol 10 Scan Time QUAD Camera 1 ON Camera 2 ON Camera 3 ON Camera 4 ON Pair CAM 1 2 3 4 Systern Setup Factory Reset

'

Auf die Taste «M» des Empfängers drücken. Auf «SCAN TIME» mit den Tasten W und X die Zeit für den Bilddurchlauf (5, 10, 15, 20 Sekunden) oder die Anzeige im QUAD Modus auswählen.

(Erinnerung: nur die Kameras im «ON» Modus sind sichtbar, siehe Absatz d).

CFI EXTEL WESV 82600 - 10/2011 - V1

CH1

CH2

Die Kamera 1 oben links auf dem Bildschirm Die Kamera 2 oben rechts auf dem Bildschirm Die Kamera 3 unten links auf dem Bildschirm Die Kamera 4 unten rechts auf dem Bildschirm

Schwarzer Bildschirm für nicht angeschlossene Kameras oder nicht aktivierte (OFF). CH3

CH4

Anmerkung: im QUAD Modus sind die Tasten «M» und nicht aktiv. Sie müssen zuerst aus dem QUAD Modus gehen indem sie auf S TW X .

h. Zoom-Funktion Auf den Knopf des Handsenders drücken, um das Video der ausgewählten Kamera zu zoomen. Sie haben die Möglichkeit das gezoomte Video mit Hilfe der Pfeile S TW X des Handsenders oder Monitors zu verschieben. Erneut auf diesen Knopf drücken, um das ursprüngliche Video wiederzuﬁnden.

i. Signalqualität Die Qualität des Empfängers wird durch Balken links neben dem Antennensymbol oben links vom Video angezeigt. Je mehr Balken sichtbar sind, desto besser ist die Qualität des Signals. Siehe Abbildung unten. Signalniveau

Durchlauf

VGA FPS

QVGA FPS

1062~1280Kbps

5~10Fps

15~30Fps

725~1062Kbps

3~5Fps

12~20Fps

Mittel

543~725Kbps

2~4Fps

8~15Fps

Niedrig

250~543Kbps

0~1Fps

0~4Fps

0~250Kbps

0Fps

0Fps

Sehr gut Gut

Nicht vorhanden

Anzeige

CFI EXTEL WESV 82600 - 10/2011 - V1

'

7. ANZEIGE AUF PC

1

2

Nicht das RCA Kabel für diese Art von Anschluss verwenden

ACHTUNG

'

Sie müssen unbedingt die mitgelieferte Software auf ihrem PC installiert haben, bevor der Empfänger angeschlossen wird.

CFI EXTEL WESV 82600 - 10/2011 - V1

8. BETRIEB UND VERWENDUNG EINES BAUSATZES

a. Software Installation mit mitgelieferter CD-Rom « GUARDING HOME EDITION » Legen sie die mitgelieferte CD-Rom in ihren CD-Spieler, um die Software «GUARDING RECORDER» zu installieren. Installationsstart «Autorun»

Die Sprache ihrer Wahl ankreuzen und mit » bestätigen

Mit » bestätigen

Folgen sie den Anweisungen « ok »

Klicken sie auf «Weiter» um weiter zu gehen Klicken sie auf «durchlaufen», um das Dossier zu ändern

CFI EXTEL WESV 82600 - 10/2011 - V1

'

Speichern der Software Lizenz : Während der Installation den Namen und Code speichern, die auf dem Umschlag der mitgelieferten CD-Rom vermerkt sind, dabei unbedingt die Klein- und Großschreibung und die Syntax des Codes beachten: xx-xxxx-xxxx-xxxx-xxxx-xxxx-xxxx

b. Monitoranschluss

2

Das USB Kabel (im Bausatz inbegriffen) mit der auf der Monitorrückseite anschließen sowie auf dem USB Port auf dem PC. Gleich nach dem Anschluss erscheint eine Nachricht die besagt, dass das Material unten links auf dem Monitor betriebsbereit ist. Doppelter Klick auf das Icon auf ihrem Büro.

'

CFI EXTEL WESV 82600 - 10/2011 - V1

c. Präsentation der Software «SCHUTZ EINSPEICHERN»

Das Programm in den Balken unten links einführen Das Programm auf der Arbeitsleiste verkleinern x Das Programm schließen F

Menüerweiterung

Kameraindikators

1

2

3

4

5

6

7

8

1. Indikator für Kameraanschluss und Ton 2. Sicherheitseinstellungen 3.Videoempfang 4. Fotoaufnahme 5. Liste der Vorfälle 6. Konﬁguration der Anzeige 7. Übrigens? Software Version - Blockschrift - Lizenz einspeichern 8. Zoom /Direktionskontrollfeld

CFI EXTEL WESV 82600 - 10/2011 - V1

'

I - INDIKATOR FÜR KAMERAANSCHLUSS UND TON

Zeigt die Qualität des Kamerasignals und ihre Tätigkeit an Zeigt nicht die angeschlossene Kamera und ihre Tätigkeit an

II - SICHERHEITSEINSTELLUNGEN

a. Bewegungsmelder Sie können dieses Videoüberwachungssystem als Alarmsystem verwenden. Eine Bewegung im Kamerafeld löst einen Alarm aus und wird aufgezeichnet entsprechend der Konﬁguration, die sie parametriert haben.

Niveau der Sensibilität Einstellung von 0 bis 100 Einstellung für die Alarmdauer

Nur Alarmeinstellung oder Alarm und Aufzeichnung: Bei jeder Bewegung wird eine Aufzeichnung in dem vom Verwender parametrierten Dossier ausgelöst. Datenspeicherung der Einstellungen Kapitel a. Kapitel b. Kapitel c.

'

CFI EXTEL WESV 82600 - 10/2011 - V1

b. Programmierung der Speicherereignisse Parametrierung über 24 Std.

Segmentierung über 2 Std. Abschnitte Wahl des Ereignistyps Wahl der je nach Ereignistyp ausgewählten Kamera

Wahl der Auﬂösung Wahl des eingespeicherten Formats bei einer Aufﬁndung (Videoclip oder Foto) Dieses Icon anklicken, um die Einstellungen einzuspeichern

: ermöglicht, ein Video während eines angegebenen Zeitraums einzuspeichern. Das Video wird direkt in dem vom Verwender gewählten Dossier abgespeichert (siehe folgendes Kapitel). : Der Bewegungsmelder aktiviert die Aufnahme eines Films oder einer Fotoserie Es wird nur ein einziger Videoﬂuß eingespeichert (1 einzige Kamera zur Zeit).

c. Programmierung Speicherverzeichnis Parametrierung des Speicherverzeichnisses durch anklicken des Icons des gelben Dossiers. Es besteht die Möglichkeit ihr Speicherdossier zu ändern. Parameter für den Speicherzeitraum eines Datenblatts. Beispiel: 7 Tage oder weniger. Nach Bestätigung werden die Dateien aufbewahrt. Dieses Icon anklicken, um die Einstellungen abzuspeichern.

CFI EXTEL WESV 82600 - 10/2011 - V1

'

III - VIDEOAUFNAHME Wahl eines Speicherverzeichnisses Löschen des vorherig abgespeicherten Videos

1. Einspeichern des auf dem Bildschirm angezeigten Videos. Es erscheint ein roter Punkt auf dem Bildschirm 2. Verlangsamung des Videos im Abspielmodus bis zu /16 3. Abspielen des eingespeicherten Videos 4. Schnelllauf des Videos im Abspielmodus bis zu x 10 5. Stoppen des Videos während des Abspielens 1

2

3

4

5

IV - FOTOAUFNAHME

1

2

3

4

5

6

1.Beim Anklicken dieses Icons kann ein Foto von dem angezeigten Bild auf dem Bildschirm gemacht werden - die Fotos werden zeitweise in dem unteren Rechteck eingespeichert 2. Speichert aufgenommene Fotos in einem Dossier ihrer Wahl ab 3. Löscht die neuesten bis zum ältesten Foto 4. Speichert alle im Rechteck angegebenen Fotos in einem Verzeichnis ihrer Wahl 5. Löscht alle im Rechteck angegebenen Fotos 6. Druckt ein Foto, das im Rechteck hervorgehoben ist

'

CFI EXTEL WESV 82600 - 10/2011 - V1

V - LISTE DER EREIGNISSE 1

2

3

4

5

1. Sortiert die Aufnahmen nach Kameraname 2. Sortiert die Aufnahmen nach Alter der Daten 3. Sortiert die Aufnahmen nach Modus (Aufnahmetyp) Foto oder Clip... 4. Löschen einer Aufnahme 5. Löschen aller Foto- und Videoaufnahmen

Gibt das Datum und die Uhrzeit eines Alarms durch den Bewegungsmelder an und nimmt ein Video in «avi» Format auf. Indem eine Videodatei hervorgehoben wird, erscheint ein Kontrollpanel:

-Verlagsamung des Videos im Abspielmodus bis zu /16 -Abspielen des Videos eingespeichert -Schnelllauf des Videos im Abspielmodus bis zu x 10 -Stoppen des Videos während des Abspielmodus

CFI EXTEL WESV 82600 - 10/2011 - V1

'

Gibt das Datum und die Uhrzeit eines durch den Bewegungsmelder aufgenommenen Fotos an sowie die Aufnahme eines Fotosalarms.

Für jede Ereignisfunktion ist das abgespeicherte Dossier unterschiedlich. Das Programm schreibt in das ausgewählte Speicherdossier jede unterschiedliche Gruppe ein, je nach Funktion.

Dossier für Alarm mit programmierter Aufﬁndung Dossier für programmierte Videoaufnahme Dossier vom Verwender kontrolliertem Videoclip

'

CFI EXTEL WESV 82600 - 10/2011 - V1

VI - KONFIGURATION DER ANZEIGE

Das Icon anklicken Kapitel a. Kapitel b. Kapitel c.

Es erscheint folgendes Menü

a. Gerät : nicht verwendet

b. Anzeige Pufferzeitraum: Zeigt Uhrzeit und Datum an oder verdeckt diese Kameraname: Zeigt den Kameranamen an oder verdeckt diesen

Ermöglicht den Kameras Namen zuzuteilen Wichtig: Dieses Icon anklicken, um abzuspeichern

c. Sprachen

Wählt die für die Software verwendete Sprache aus.

CFI EXTEL WESV 82600 - 10/2011 - V1

'

VII - ÜBRIGENS? SOFTWAREVERSION

Das Icon anklicken

1-Zeigt die Softwareversion an 2-Zeigt die Aktivierung der Software an (Lizenzeinspeicherung) 3-Überprüft die Aktualisierung der Software über Internet (nicht verwendet)

VIII - ZOOM / DIREKTIONSKONTROLLPANEL

Normale Anzeige

'

Zommodus aktiv (die Pfeile werden gültig)

CFI EXTEL WESV 82600 - 10/2011 - V1

9. WARTUNG Die Garantie erlöscht wenn sie Teile ausbauen. Außen nur mit einem trockenen weichen Tuch reinigen. Vor der Reinigung, das Videoüberwachungssystem vom Stromkreis unterbrechen. Achtung: Kein Produkt oder Benzin, Kalkungscarbonatation, Alkohol oder ähnliches verwenden. Sie riskieren nicht nur ihr Gerät zu beschädigen, sondern die Dämpfe können ebenfalls ihrer Gesundheit schädigen und sich entzünden. Kein Werkzeug verwenden, das Spannung leiten könnte (Metallbürste, spitzes Werkzeug... oder anderes)

10. PANNENHILFE A Mit diesem Videoüberwachungssystem, haben sie ein Produkt der neuesten Technologie erstanden, dass sofort einsatzbereit ist. Es werden alle Teile mitgeliefert, damit sie voll und ganz von ihrem Bausatz proﬁtieren können. Sollten sie trotzdem auf Probleme oder Funktionsstörungen stoßen, können sie diesen Fehlern abhilfe leisten indem sie die folgende Tabelle lesen: Panne

Grund

Lösung

Der Empfänger schaltet sich Problem mit dem Stromans- Den Anschluss des Adapters nicht ein chluss überprüfen Kein Bild sowie Angabe «kein Signal»

• Die Kamera hat keinen Stromanschluss • Die Kamera wurde nicht angeschlossen • Das Signal wird nicht vom Empfänger empfangen

• Den Anschluss des Adapters überprüfen • Lesen im Kapitel 6 c nach. • Die Kamera näher und an einem geeigneteren Platz befestigen

Es ist nicht möglich die Zusatzkameras anzuzeigen

Die Kameras sind nicht auf dem Empfänger bestätigt

Lesen im Kapitel 6 d nach.

Der Handsender funktioniert nicht

• Bei der ersten Verwendung die Schutzlasche auf der Batterie entfernen • Die Batterie austauschen

Bei Bedarf steht ihnen unsere technische Website zur Verfügung www.cﬁ-extel.com

CFI EXTEL WESV 82600 - 10/2011 - V1

'

11. SICHERHEITSEMPFHLUNGEN Schäden, die durch einen Mangel an Konformität mit dem Handbuch hervorgerufen wurden, führen zu einer Löschung der Garantie. Wir übernehmen keine Haftung für daraus entstandene Schäden! Wir übernehmen keine Haftung für Schäden an Gegenständen oder Personen, die durch eine nicht geeignete Handhabung oder einem Mangel an Konformität der Sicherheitsempfehlungen entstanden sind. Dieses Produkt wurde mit Respekt auf die Sicherheitsempfehlungen hergestellt. Um diesen Status zu erhalten und um einen korrekten Gebrauch dieses Produkts zu erhalten, muss der Verbraucher die in diesem Handbuch enthaltenen Sicherheitsratschläge und Warnungen respektieren. Der Verwender ist dafür verantwortlich, zu überprüfen ob das Videoüberwachungssystem den geltenen Gesetzen im Verwendungsland entspricht.

ACHTUNG

Der Verwender wird auf wichtige Anweisungen hinsichtlich der Verwendung und Wartung (Reparatur) in dem das Gerät begleitenen Dokument hingewiesen. Warnt den Verwender vor nicht isolierten «gefährlichen Spannungen» im Inneren des Produktgehäuses, die ausreichend sind, um für Menschen eine Gefahr für einen tödlichen Elektroschock darzustellen.

Dieses Symbol gibt eine Gefahr auf Elektroschock oder Kurzschluss an. - Sie dürfen dieses Gerät nur verwenden mit einer Spannung zwischen: 100 - 240 Volt und 50-60 Herz.Versuchen sie niemals dieses Gerät mit einer anderen Spannung zu verwenden. - Achten sie darauf, dass alle an dieses System angeschlossenen elektrischen Anschlüsse, den Verwendungsratschlägen entsprechen. - In kommerziellen Einrichtungen versichern sie sich, dass die Schutzregeln für Unfälle mit elektrischen Installationen beachtet werden. - In Schulen, Ausbildungsausrüstungen, Werkstätten... ist die Gegenwart von qualiﬁziertem Personal notwendig, um den Betrieb von Elektrogeräten zu kontrollieren. - Die Verwendungsratschläge der an das System angeschlossenen Geräten beachten (z.B. Videorekorder, TV, PC) - Bei Zweifelsfällen hinsichtlich des Betriebs oder Sicherheit des Geräts, kontaktieren sie bitte erfahrene Personen - Niemals elektrische Geräte mit feuchten Händen ein- oder ausschalten. - Bei der Installation dieses Produkts bitte darauf achten, dass die Stromkabel nicht beschädigt werden können. - Sie sollten niemals selbst ein beschädigtes Stromkabel ersetzen! In diesem Fall dieses entfernen und Rat bei einer erfahrenen Person suchen. '

CFI EXTEL WESV 82600 - 10/2011 - V1

12. FCC/CE WARNUNG Anmerkung: Diese Ausrüstung wurde getestet und entspricht den Anforderungen eines Geräts der Klasse B entsprechend der gültigen europäischen Normen. Diese Anforderungen wurden erstellt, um einen vernünftigen Schutz gegen Interferenzen für eine Installation in einem Wohnhaus zu leisten. Diese Ausrüstung kann eine Funkfrequenzenergie verwenden und ausstrahlen. Sollte es nicht gemäß der Anweisungen installiert und verwendet werden, kann es Interferenzen aus Funkkommunikationen provozieren. Jedoch gibt es keine Garantie, dass sich Interferenzen in einer privaten Installation produzieren. Wenn diese Ausrüstung Interferenzen durch Funk- oder TV-Empfänge provozieren sollte, kann dies dadurch festgestellt werden, indem die Ausrüstung ein oder ausgeschaltet wird. Der Verwender wird darum gebeten die Interferenzen zu ändern, indem er mindestens eine der folgenden Maßnahmen durchführt: • Die Empfangsantenne neu orientieren oder verstellen • Den Abstand zwischen Ausrüstung und Empfänger vergrößern • Die Ausrüstung an eine Steckdose anschließen, an der nicht der Empfänger angeschlossen ist.

FCC/CE Mitteilung Es müssen einige Regeln beachtet werden: Geräte, die Funkwellen verwenden entsprechen gezwungener Maßen Regeln und Bestimmungen. Deswegen ist die Stärke des Senders begrenzt. Ein Empfänger kann nicht mehr als einem Signal zur Zeit antworten und deswegen von nahen Funksignalen in seinen Funktionsfrequenzen gestört werden.

CFI EXTEL WESV 82600 - 10/2011 - V1

'

)D[

&),=,GH)pWDQ 75e928;²)UDQFH WpO 6$6DXFDSLWDOGH ½ QVLUHW%285*

3URFpGXUHVXLYLH$QQH[HV *HYROJGHSURFHGXUHELMODJHQ 3URFHGXUDVHJXLWDDOOHJDWL 3URFHGLPLHQWR VHJXLGR$QH[RV 3URFHVVRVHJXLGR$QH[RV %HZHUWXQJVYHUIDKUHQ$QODJHQ )ROORZHGSURFHGXUH$QQH[HV ,,,

1XPpURG LGHQWLILFDWLRQ ,GHQWLILFDWLHQXPPHU1XPHURGL LGHQWLILFD]LRQHGHOOҋRUJDQLVPR 1~PHURGH LGHQWLILFDFLyQ1~PHURGHLGHQWLILFDomR.HQQXPPHU,GHQWLILFDWLRQQXPEHU

,GHQWLILFDWLRQGHOҋRUJDQLVPHQRWLILpLGHQWLILFDWLHYDQQHWDDQJHZH]HQRUJDQLVPH ,GHQWLILFD]LRQH GHOOҋRUJDQLVPRQRWLILFDWR ,GHQWLILFDFLyQGHORUJDQLVPRQRWLILFDGR,GHQWLILFDomRGR2UJDQLVPRQRWLILFDGR ,GHQWLIL]LHUXQJGHUEHQQDQQWHQ ,GHQWLILFDWLRQRIWKH1RWLILHGERG\ 1RP 1DDP1RPH1RPEUH 1RPH1DPH1DPH

$XWUHVLQIRUPDWLRQV $QGHUHLQIRUPDWLHV$OWUDLQIRUPD]LRQH 2WUDVLQIRUPDFLRQHV 2XWUDVLQIRUPDo}HV 6RQVWLJH$QJDEHQ 2WKHULQIRUPDWLRQ

5pIpUHQFHFRPPHUFLDOH &RPPHUFLsOHUHIHUHQWLH5LIHULPHQWRFRPPHUFLDOH5HIHUHQFLDFRPHUFLDO 5HIHUrQFLDFRPHUFLDO3URGXNWEH]HLFKQXQJ &RPPHUFLDOUHIHUHQFH (;7(/

7\SH 7\SH 7LSR7LSR 7LSR 7\S7\SH 695&

1DWXUH 6RRUW 1DWXUD 1DWXUDOH]D *pQHUR $UW .LQGUpFHSWHXUUDGLR UDGLRHPSIkQJHUULFHYLWRUHUDGLRUHFHSWRUUDGLRUHFHSWRUGHUDGLR )XQNHPSIlQJHU UDGLR UHFHLYHU

,GHQWLILFDWLRQGXSURGXLW ,GHQWLILFDWLHYDQKHWSURGXNW,GHQWLILFD]LRQHGHOSURGRWWR ,GHQWLILFDFLyQGHOSURGXFWR ,GHQWLILFDomRGRSURGXWR3URGXNWPHUNPDOH ,GHQWLILFDWLRQRIWKHSURGXFW

$OOpHGH)pWDQ=,GH)pWDQ %3 75(928;FHGH[)UDQFH

$GUHVVH $UGUHV ,QGLUL]]R 'LUHFFLyQ (QGHUHoR$GUHVVH $GGUHVV

&RPSWRLU)UDQoDLVGHO ,QWHUSKRQH²&),7HO

6LqJHVRFLDO +RRIGNDQWRRU 'RPLFLOLRVRFLDO 'RPLFLOLRVRFLDO 6HGHVRFLDO)LUPHQVLW]&RPSDQ\ QDPH

1RP 1DDP1RPEUH 1RPEUH1RPH1DPH1DPH 0;DYLHU%$,/2GLUHFWHXUJpQpUDO IDEULFDQWPDQGDWDLUHRXSHUVRQQHUHVSRQVDEOHGHODPLVHVXUOHPDUFKpGHO pTXLSHPHQW IDEULNDQWJHYROPDFKWLJGHRIYHUDQWZRRUGHOLMNHYRRUKHWRSGHPDUNWEUHQJHQYDQGHXLWUXVWLQJ IDEEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDELOHGHOOҋLQWURGX]LRQHGHOSURGRWWRVXOPHUFDWR IDEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDEOHGHODSXHVWDHQHOPHUFDGRGHOHTXLSR IDEULFDQWHPDQGDWiULRRXUHSUHVHQWDQWHOHJDOSHODFRORFDomRGRHTXLSDPHQWRQR0HUFDGR GHV+HUVWHOOHUVVHLQHV%HYROOPlFKWLJWHQRGHUGHUIUGDV,QYHUNHKUEULQJHQGHV*HUlWVYHUDQWZRUWOLFKHQ3HUVRQ PDQXIDFWHURUSHUVRQUHVSRQVLEOH

'(&/$5$7,21'(&21)250,7( 29(5((1.20679(5./$5,1* ',&+,$5$=,21(',&21)250,7$ '(&/$5$&,Ð1'(&21)250,'$' '(&/$5$d®2'(&21)250,'$'( .21)250,7b76(5./b581* '(&/$5$7,212)&21)250,7<

&),=,GH)pWDQ 75e928;²)UDQFH WpO 6$6DXFDSLWDOGH ½ QVLUHW%285*

695&

6LJQDWXUHHWWLWUH +DQGWHNHQLQJHQIXQFWLH )LUPDHWLWROR)LUPD\FDUJR$VVLQDWXUDHWtWXOR8QWHUVFKULIW XQGIXQNWLRQ6LJQDWXUHDQGWLWOH 0;DYLHU%$,/2GLUHFWHXUJpQpUDO SHUVRQQHDXWRULVpH EHYRHJGSHUVRRQSHUVRQDDXWRUL]]DWD SHUVRQDDXWRUL]DGD UHSUHVHQWDQWHOHJDO DXWRULVLHUWH3HUVRQDXWKRUL]HGSHUVRQ

'DWH 'DWXP'DWD'DWD'DWD 'DWXP 'DWH

$UWpYHQWXHO HYHQWXHHO HYHQWXDOH HYHQWXDO HYHQWXDO HYHQWXHOO HYHQWXDO

'HFODUHVWKDWDOOWKHUHTXLUHGUDGLRWHVWVKDYHEHHQGRQH

$FHWHIIHWGpFODUHTXHWRXWHVOHVVpULHVG HVVDLVUDGLRRQWpWpHIIHFWXpHV 9HUNODDUWGDDUWRHGDWDOOHVHULHVUDGLR WHVWHQXLWJHYRHUG]LMQ $WDOHHIIHWWRGLFKLDUDFKHWXWWHOHSURYHUDGLRVRQRVWDWHHVHJXLWH $WDOHIHFWRGHFODUDTXHVHKDQHIHFWXDGRWRGDVODVVHULHVGHSUXHEDVUDGLR3DUDRHIHLWRGHFODUDTXH IRUDPHIHFWXDGDVWRGDVDVVpULHVGHHQVDLRVGHUiGLR (UNOlUWGDVVDOOH)XQN7HVWUHLKHQGXUFKJHIKUWZXUGHQ

««(76,(19

$UWLFOHERQQHXWLOLVDWLRQGXVSHFWUHUDGLRpOHFWULTXHGHIDoRQjpYLWHUOHVLQWHUIpUHQFHVGRPPDJHDEOHV $UWLNHOMXLVWJHEUXLNYDQKHWUDGLRHOHNWULVFKVSHFWUXPRPEHVFKDGLJHQGHLQWHUIHUHQWLHVRSGLHPDQLHUXLWGH ZHJWHJDDQ $UWLFRORXVRFRUUHWWRGHOORVSHWWURUDGLRHOHWWULFRSHUHYLWDUHOHLQWHUIHUHQ]HGDQQHJJLDELOL $UWtFXORFRUUHFWDXWLOL]DFLyQGHOHVSHFWURUDGLRHOpFWULFRSDUDHYLWDULQWHUIHUHQFLDVSHUMXGLFLDOHV $UWLJRERDXWLOL]DomRGRHVSHFWURUDGLRHOpFWULFRGHIRUPDDHYLWDUDVLQWHUIHUrQFLDVGDQLILFDGRUDV $UWLNHODQJHPHVVHQH1XW]XQJGHV)XQNVSHNWUXPV]XU9HUPHLGXQJYRQVFKlGLFKHQ,QWHUIHUHQ]HQ $UWLFOHULJKWXVHRIWKHUDGLRHOHFWULFVSHFWUXPLQRUGHUWRDYRLGHSUHMXGLFLDOLQWHUIHUHQFHV

«« (19 B(19

$UWLFOHE H[LJHQFHVGHODSURWHFWLRQHQFHTXLFRQFHUQHODFRPSDWLELOLWppOHFWURPDJQpWLTXH $UWLNHOEEHVFKHUPLQJVHLVHQZDWGHHOHNWURPDJQHWLVFKHRYHUHHQVWHPPLQJEHWUHIW $UWLFROREHVLJHQ]HGHOODSURWH]LRQHUHODWLYDDOODFRPSDWLELOLWjHOHWWURPDJQHWLFD $UWtFXOREH[LJHQFLDVGHODSURWHFFLyQHQFXDQWRDODFRPSDWLELOLGDGHOHFWURPDJQpWLFD $UWLJREUHTXLVLWRVGHSURWHFomRUHODWLYDjFRPSDWLELOLGDGHHOHFWURPDJQpWLFD $UWLNHOE6KXW]DQIRUGHUXQJHQLQ%H]XJDXIGLHHOHNWURPDJQHWLVFKH9HUWUlJOLFKNHLW $UWLNHOE5HTXLUHPHQWVRISURWHFWLRQUHDJDUGLQJHOHFWURPDJQHWLFFRPSDWLELOLW\

«« (1

$UWLFOHDSURWHFWLRQGHODVDQWpHWGHODVpFXULWpGHO XWLOLVDWHXU $UWLNHODEHVFKHUPLQJYDQGHJH]RQGKHLGHQYHLOLJKHLGYRRUGHJHEUXLNHU $UWLFRORDSURWH]LRQHGHOODVDOXWHHGHOODVLFXUH]]DGHOOҋXWHQWH $UWtFXORDSURWHFFLyQGHODVDOXG\GHODVHJXULGDGGHOXVXDULR $UWLJRDSURWHFomRGDVD~GHHGDVHJXUDQoDGRXWLOL]DGRU $UWLNHOD6FKXW]GHU*HVXQGKHLWXQG6LFKHUKHLWGHV%HQXW]HUV $UWLFOHD6DIHW\DQGXVHU

'pFODUHVRXVVRQHQWLqUHUHVSRQVDELOLWpTXHOHSURGXLWGpFULWFLGHVVXVHVWHQFRQIRUPLWpDYHFOHVH[LJHQFHV HVVHQWLHOOHVDSSOLFDEOHVHWHQSDUWLFXOLHUFHOOHVGHODGLUHFWLYH&(VXLYDQWHV 9HUNODDUWRQGHU]LMQYROOHGLJHYHUDQWZRRUGLQJGDWKHWKLHURQGHURPVFKUHYHQSURGXNWRYHUHHQNRPWPHWGH KRRIG]DNHOLMNHWRHWHSDVVHQHLVHQHQLQKHWELM]RQGHUGLHJHQHQYROJHQVGHYROJHQGHULFKWOLMQ&( 'LFKLDUDVRWWRODSURSULDUHVSRQVDELOLWjFKHLOSURGRWWRGHVFULWWRTXLVRSUDqFRQIRUPHDOOHHVLJHQ]HHVVHQ]LDOOL DSSOOLFDELOLHLQSDUWLFRODUHDOOHHVLJHQ]HGHOODGLUHWWLYD&(VHJXHQWL 'HFODUDEDMRVXFRPSOHWDUHVSRQVDELOLGDGTXHHOSURGXFWRDQWHULRUPHQWHGHVFULWRHVFRQIRUPHDODVH[LJHQFLDV HVHQFLDOHVDSOLFDEOHVVREUHWRGRDODVH[LJHQFLDVGHODGLUHFWLYD&(TXHILJXUDQDFRQWLQXDFLyQ 'HFODUDVREDVXDUHVSRQVDELOLGDGHTXHRSURGXWRDFLPDLGHQWLILFDGRHVWiHPFRQIRUPLGDGHFRPRVUHTXLVLWRV HVVHQFLDLVDSOLFiYHLVHHPSDUWLFXODUFRPRVVHJXLQWHVUHTXLVLWRVGDGLUHFWLYD&( (UNOlUWLQHLJHQHU9HUDQWZRUWXQJGDVVGDVREHQEHVFKULHEHQH3URGXNWGLHHLQVFKOlJLJHQJUXQGOHJHQGHQ $QIRUGHUXQJHQLQVEHVRQGHUHIROJHQGH$QIRUGHUXQJHQGHU5LFKWOLQLH&(HUIOOW 'HFODUHVXQGHULWVRZQUHVSRQVLELOLW\WKDWWKHSURGXFWKHUHDERYHPHQWLRQHGLVLQFRQIRUPLW\ZLWKWKH UHTXLUHPHQWVRIWKHDQGPRUHSDUWLFXODULW\WKHRQHVRIWKH&(GLUHFWLYH

)D[

&),=,GH)pWDQ 75e928;²)UDQFH WpO 6$6DXFDSLWDOGH ½ QVLUHW%285*

3URFpGXUHVXLYLH$QQH[HV *HYROJGHSURFHGXUHELMODJHQ 3URFHGXUDVHJXLWDDOOHJDWL 3URFHGLPLHQWR VHJXLGR$QH[RV 3URFHVVRVHJXLGR$QH[RV %HZHUWXQJVYHUIDKUHQ$QODJHQ )ROORZHGSURFHGXUH$QQH[HV ,,,

1XPpURG LGHQWLILFDWLRQ ,GHQWLILFDWLHQXPPHU1XPHURGL LGHQWLILFD]LRQHGHOOҋRUJDQLVPR 1~PHURGH LGHQWLILFDFLyQ1~PHURGHLGHQWLILFDomR.HQQXPPHU,GHQWLILFDWLRQQXPEHU

,GHQWLILFDWLRQGHOҋRUJDQLVPHQRWLILpLGHQWLILFDWLHYDQQHWDDQJHZH]HQRUJDQLVPH ,GHQWLILFD]LRQH GHOOҋRUJDQLVPRQRWLILFDWR ,GHQWLILFDFLyQGHORUJDQLVPRQRWLILFDGR,GHQWLILFDomRGR2UJDQLVPRQRWLILFDGR ,GHQWLIL]LHUXQJGHUEHQQDQQWHQ ,GHQWLILFDWLRQRIWKH1RWLILHGERG\ 1RP 1DDP1RPH1RPEUH 1RPH1DPH1DPH

$XWUHVLQIRUPDWLRQV $QGHUHLQIRUPDWLHV$OWUDLQIRUPD]LRQH 2WUDVLQIRUPDFLRQHV 2XWUDVLQIRUPDo}HV 6RQVWLJH$QJDEHQ 2WKHULQIRUPDWLRQ

5pIpUHQFHFRPPHUFLDOH &RPPHUFLsOHUHIHUHQWLH5LIHULPHQWRFRPPHUFLDOH5HIHUHQFLDFRPHUFLDO 5HIHUrQFLDFRPHUFLDO3URGXNWEH]HLFKQXQJ &RPPHUFLDOUHIHUHQFH (;7(/

7\SH 7\SH 7LSR7LSR 7LSR 7\S7\SH 69&0

1DWXUH 6RRUW 1DWXUD 1DWXUDOH]D *pQHUR $UW .LQG&DPpUDVDQVILOGLJLWDOH 'UDDGOR]HFDPHUDGLJLWDOH 7HOHFDPHUDVHQ]DILOLGLJLWDOH &iPDUDLQDOiPEULFDGLJLWDO &kPDUDVHPILRVGLJLWDO 'UDKWORVH.DPHUD'LJLWDO :LUHOHVVFDPHUDGLJLWDO

,GHQWLILFDWLRQGXSURGXLW ,GHQWLILFDWLHYDQKHWSURGXNW,GHQWLILFD]LRQHGHOSURGRWWR ,GHQWLILFDFLyQGHOSURGXFWR ,GHQWLILFDomRGRSURGXWR3URGXNWPHUNPDOH ,GHQWLILFDWLRQRIWKHSURGXFW

$OOpHGH)pWDQ=,GH)pWDQ %3 75(928;FHGH[)UDQFH

$GUHVVH $UGUHV ,QGLUL]]R 'LUHFFLyQ (QGHUHoR$GUHVVH $GGUHVV

&RPSWRLU)UDQoDLVGHO ,QWHUSKRQH²&),7HO

6LqJHVRFLDO +RRIGNDQWRRU 'RPLFLOLRVRFLDO 'RPLFLOLRVRFLDO 6HGHVRFLDO)LUPHQVLW]&RPSDQ\ QDPH

1RP 1DDP1RPEUH 1RPEUH1RPH1DPH1DPH 0;DYLHU%$,/2GLUHFWHXUJpQpUDO IDEULFDQWPDQGDWDLUHRXSHUVRQQHUHVSRQVDEOHGHODPLVHVXUOHPDUFKpGHO pTXLSHPHQW IDEULNDQWJHYROPDFKWLJGHRIYHUDQWZRRUGHOLMNHYRRUKHWRSGHPDUNWEUHQJHQYDQGHXLWUXVWLQJ IDEEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDELOHGHOOҋLQWURGX]LRQHGHOSURGRWWRVXOPHUFDWR IDEULFDQWHPDQGDWDULRRSHUVRQDUHVSRQVDEOHGHODSXHVWDHQHOPHUFDGRGHOHTXLSR IDEULFDQWHPDQGDWiULRRXUHSUHVHQWDQWHOHJDOSHODFRORFDomRGRHTXLSDPHQWRQR0HUFDGR GHV+HUVWHOOHUVVHLQHV%HYROOPlFKWLJWHQRGHUGHUIUGDV,QYHUNHKUEULQJHQGHV*HUlWVYHUDQWZRUWOLFKHQ3HUVRQ PDQXIDFWHURUSHUVRQUHVSRQVLEOH

'(&/$5$7,21'(&21)250,7( 29(5((1.20679(5./$5,1* ',&+,$5$=,21(',&21)250,7$ '(&/$5$&,Ð1'(&21)250,'$' '(&/$5$d®2'(&21)250,'$'( .21)250,7b76(5./b581* '(&/$5$7,212)&21)250,7<

&),=,GH)pWDQ 75e928;²)UDQFH WpO 6$6DXFDSLWDOGH ½ QVLUHW%285*

69&0

6LJQDWXUHHWWLWUH +DQGWHNHQLQJHQIXQFWLH )LUPDHWLWROR)LUPD\FDUJR$VVLQDWXUDHWtWXOR8QWHUVFKULIW XQGIXQNWLRQ6LJQDWXUHDQGWLWOH 0;DYLHU%$,/2GLUHFWHXUJpQpUDO SHUVRQQHDXWRULVpH EHYRHJGSHUVRRQSHUVRQDDXWRUL]]DWD SHUVRQDDXWRUL]DGD UHSUHVHQWDQWHOHJDO DXWRULVLHUWH3HUVRQDXWKRUL]HGSHUVRQ

'DWH 'DWXP'DWD'DWD'DWD 'DWXP 'DWH

$UWpYHQWXHO HYHQWXHHO HYHQWXDOH HYHQWXDO HYHQWXDO HYHQWXHOO HYHQWXDO

'HFODUHVWKDWDOOWKHUHTXLUHGUDGLRWHVWVKDYHEHHQGRQH

$FHWHIIHWGpFODUHTXHWRXWHVOHVVpULHVG HVVDLVUDGLRRQWpWpHIIHFWXpHV 9HUNODDUWGDDUWRHGDWDOOHVHULHVUDGLR WHVWHQXLWJHYRHUG]LMQ $WDOHHIIHWWRGLFKLDUDFKHWXWWHOHSURYHUDGLRVRQRVWDWHHVHJXLWH $WDOHIHFWRGHFODUDTXHVHKDQHIHFWXDGRWRGDVODVVHULHVGHSUXHEDVUDGLR3DUDRHIHLWRGHFODUDTXH IRUDPHIHFWXDGDVWRGDVDVVpULHVGHHQVDLRVGHUiGLR (UNOlUWGDVVDOOH)XQN7HVWUHLKHQGXUFKJHIKUWZXUGHQ

««(76,(19

$UWLFOHERQQHXWLOLVDWLRQGXVSHFWUHUDGLRpOHFWULTXHGHIDoRQjpYLWHUOHVLQWHUIpUHQFHVGRPPDJHDEOHV $UWLNHOMXLVWJHEUXLNYDQKHWUDGLRHOHNWULVFKVSHFWUXPRPEHVFKDGLJHQGHLQWHUIHUHQWLHVRSGLHPDQLHUXLWGH ZHJWHJDDQ $UWLFRORXVRFRUUHWWRGHOORVSHWWURUDGLRHOHWWULFRSHUHYLWDUHOHLQWHUIHUHQ]HGDQQHJJLDELOL $UWtFXORFRUUHFWDXWLOL]DFLyQGHOHVSHFWURUDGLRHOpFWULFRSDUDHYLWDULQWHUIHUHQFLDVSHUMXGLFLDOHV $UWLJRERDXWLOL]DomRGRHVSHFWURUDGLRHOpFWULFRGHIRUPDDHYLWDUDVLQWHUIHUrQFLDVGDQLILFDGRUDV $UWLNHODQJHPHVVHQH1XW]XQJGHV)XQNVSHNWUXPV]XU9HUPHLGXQJYRQVFKlGLFKHQ,QWHUIHUHQ]HQ $UWLFOHULJKWXVHRIWKHUDGLRHOHFWULFVSHFWUXPLQRUGHUWRDYRLGHSUHMXGLFLDOLQWHUIHUHQFHV

«« (19 B(19

$UWLFOHE H[LJHQFHVGHODSURWHFWLRQHQFHTXLFRQFHUQHODFRPSDWLELOLWppOHFWURPDJQpWLTXH $UWLNHOEEHVFKHUPLQJVHLVHQZDWGHHOHNWURPDJQHWLVFKHRYHUHHQVWHPPLQJEHWUHIW $UWLFROREHVLJHQ]HGHOODSURWH]LRQHUHODWLYDDOODFRPSDWLELOLWjHOHWWURPDJQHWLFD $UWtFXOREH[LJHQFLDVGHODSURWHFFLyQHQFXDQWRDODFRPSDWLELOLGDGHOHFWURPDJQpWLFD $UWLJREUHTXLVLWRVGHSURWHFomRUHODWLYDjFRPSDWLELOLGDGHHOHFWURPDJQpWLFD $UWLNHOE6KXW]DQIRUGHUXQJHQLQ%H]XJDXIGLHHOHNWURPDJQHWLVFKH9HUWUlJOLFKNHLW $UWLNHOE5HTXLUHPHQWVRISURWHFWLRQUHDJDUGLQJHOHFWURPDJQHWLFFRPSDWLELOLW\

««(1

$UWLFOHDSURWHFWLRQGHODVDQWpHWGHODVpFXULWpGHO XWLOLVDWHXU $UWLNHODEHVFKHUPLQJYDQGHJH]RQGKHLGHQYHLOLJKHLGYRRUGHJHEUXLNHU $UWLFRORDSURWH]LRQHGHOODVDOXWHHGHOODVLFXUH]]DGHOOҋXWHQWH $UWtFXORDSURWHFFLyQGHODVDOXG\GHODVHJXULGDGGHOXVXDULR $UWLJRDSURWHFomRGDVD~GHHGDVHJXUDQoDGRXWLOL]DGRU $UWLNHOD6FKXW]GHU*HVXQGKHLWXQG6LFKHUKHLWGHV%HQXW]HUV $UWLFOHD6DIHW\DQGXVHU

'pFODUHVRXVVRQHQWLqUHUHVSRQVDELOLWpTXHOHSURGXLWGpFULWFLGHVVXVHVWHQFRQIRUPLWpDYHFOHVH[LJHQFHV HVVHQWLHOOHVDSSOLFDEOHVHWHQSDUWLFXOLHUFHOOHVGHODGLUHFWLYH&(VXLYDQWHV 9HUNODDUWRQGHU]LMQYROOHGLJHYHUDQWZRRUGLQJGDWKHWKLHURQGHURPVFKUHYHQSURGXNWRYHUHHQNRPWPHWGH KRRIG]DNHOLMNHWRHWHSDVVHQHLVHQHQLQKHWELM]RQGHUGLHJHQHQYROJHQVGHYROJHQGHULFKWOLMQ&( 'LFKLDUDVRWWRODSURSULDUHVSRQVDELOLWjFKHLOSURGRWWRGHVFULWWRTXLVRSUDqFRQIRUPHDOOHHVLJHQ]HHVVHQ]LDOOL DSSOOLFDELOLHLQSDUWLFRODUHDOOHHVLJHQ]HGHOODGLUHWWLYD&(VHJXHQWL 'HFODUDEDMRVXFRPSOHWDUHVSRQVDELOLGDGTXHHOSURGXFWRDQWHULRUPHQWHGHVFULWRHVFRQIRUPHDODVH[LJHQFLDV HVHQFLDOHVDSOLFDEOHVVREUHWRGRDODVH[LJHQFLDVGHODGLUHFWLYD&(TXHILJXUDQDFRQWLQXDFLyQ 'HFODUDVREDVXDUHVSRQVDELOLGDGHTXHRSURGXWRDFLPDLGHQWLILFDGRHVWiHPFRQIRUPLGDGHFRPRVUHTXLVLWRV HVVHQFLDLVDSOLFiYHLVHHPSDUWLFXODUFRPRVVHJXLQWHVUHTXLVLWRVGDGLUHFWLYD&( (UNOlUWLQHLJHQHU9HUDQWZRUWXQJGDVVGDVREHQEHVFKULHEHQH3URGXNWGLHHLQVFKOlJLJHQJUXQGOHJHQGHQ $QIRUGHUXQJHQLQVEHVRQGHUHIROJHQGH$QIRUGHUXQJHQGHU5LFKWOLQLH&(HUIOOW 'HFODUHVXQGHULWVRZQUHVSRQVLELOLW\WKDWWKHSURGXFWKHUHDERYHPHQWLRQHGLVLQFRQIRUPLW\ZLWKWKH UHTXLUHPHQWVRIWKHDQGPRUHSDUWLFXODULW\WKHRQHVRIWKH&(GLUHFWLYH

FR - Ne jetez pas les piles et les appareils hors d’usage avec les ordures ménagères. Les substances dangereuses qu’ils sont susceptibles de contenir peuvent nuire à la santé et à l’environnement. Faites reprendre ces appareils par votre distributeur ou utilisez les moyens de collecte sélective mise à votre disposition par votre commune. I - Non gettare le pile e le apparecchiature fuori uso insieme ai rifiuti domestici. Le sostanze dannose contenute in esse possono nuocere alla salute dell’ambiente. Restituire questo materiale al distributore o utilizzare la raccolta differenziata organizzata dal comune. E - No tire las pilas ni los aparatos inservibles con los residuos domésticos, ya que las sustancias peligrosas que puedan contener pueden perjudicar la salud y al medio ambiente. Pídale a su distribuidor que los recupere o utilice los medios de recogida selectiva puestos a su disposición por el ayuntamiento. P - Não junte as pilhas nem os aparelhos que já não se usam com o lixo caseiro. As substâncias perigosas que ambos podem conter podem ser prejudiciais para a saúde e para o ambiente. Entregue esses aparelhos ao seu lixeiro ou recorra aos meios de recolha selectiva ao seu dispor. NL - De lege batterijen en oude apparaten niet met het huisvuil meegeven: deze kunnen gevaarlijke stoffen bevatten die de gezondheid en het milieu schaden. De oude apparaten door uw distributeur laten innemen of de gescheiden vuilinzameling van uw gemeente gebruiken. GB - Don’t throw batteries or out of order products with the household waste (garbage). The dangerous substances that they are likely to include may harm health or the environment. Make your retailer take back these products or use the selective collect of garbage proposed by your city. D - Verbrauchte Batterien und nicht mehr benützte Geräte sind Sondermüll. Sie enthalten möglicherweise gesundheits- und umweltschädliche Substanzen. Geben Sie alte Geräte zur fachgerechten Entsorgung beim Gerätehändler ab bzw. benutzen Sie die örtlichen Recyclinghöfe.

Conforme R&TTE, utilisable dans la C.E.E. Conforme R&TTE, utilzzabile nei paesi C.E.E. Conforme R&TTE, usado en de la C.E.E. ConformR&TTE, utilizàvel na C.E.E. Conform product R&TTE, te gebruiken in de EEG Compliant with R&TTE, usable in the EEC Entspricht der R&TTE, in der EWG verwendbar

Découvrez nos produits sur :

www.cﬁ-extel.com,,

Printed in P.R.C.

• France : Hotline : 0 892 350 069 (0,337€ ttc/min) • Italia : Assistenza Tecnica : +39 02 96488273 [email protected] • España : Asistencia técnica : 902 109 819 [email protected] • Portugal : Serviço de apoio ao cliente : 707 201 138

&

.

Recommend Stories

Story Transcript

Get in touch

Social